Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ACTG2 expression in transfected 293T cell line by ACTG2 polyclonal antibody. Lane 1: ACTG2 transfected lysate (41.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ACTG2 Polyclonal Antibody | anti-ACTG2 antibody

ACTG2 (Actin, gamma-enteric Smooth Muscle, Alpha-actin-3, Gamma-2-actin, Smooth Muscle gamma-actin, ACTA3, ACTL3, ACTSG) (Biotin)

Gene Names
ACTG2; ACT; ACTE; VSCM; ACTA3; ACTL3; ACTSG
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACTG2; Polyclonal Antibody; ACTG2 (Actin; gamma-enteric Smooth Muscle; Alpha-actin-3; Gamma-2-actin; Smooth Muscle gamma-actin; ACTA3; ACTL3; ACTSG) (Biotin); anti-ACTG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ACTG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ACTG2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ACTG2, aa1-376 (NP_001606.1).
Immunogen Sequence
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ACTG2 expression in transfected 293T cell line by ACTG2 polyclonal antibody. Lane 1: ACTG2 transfected lysate (41.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ACTG2 expression in transfected 293T cell line by ACTG2 polyclonal antibody. Lane 1: ACTG2 transfected lysate (41.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ACTG2 antibody
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Product Categories/Family for anti-ACTG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
72
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,877 Da
NCBI Official Full Name
actin, gamma-enteric smooth muscle isoform 1
NCBI Official Synonym Full Names
actin, gamma 2, smooth muscle, enteric
NCBI Official Symbol
ACTG2
NCBI Official Synonym Symbols
ACT; ACTE; VSCM; ACTA3; ACTL3; ACTSG
NCBI Protein Information
actin, gamma-enteric smooth muscle; alpha-actin-3; actin-like protein
UniProt Protein Name
Actin, gamma-enteric smooth muscle
Protein Family
UniProt Gene Name
ACTG2
UniProt Synonym Gene Names
ACTA3; ACTL3; ACTSG
UniProt Entry Name
ACTH_HUMAN

NCBI Description

Actins are highly conserved proteins that are involved in various types of cell motility and in the maintenance of the cytoskeleton. Three types of actins, alpha, beta and gamma, have been identified in vertebrates. Alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton and as mediators of internal cell motility. This gene encodes actin gamma 2; a smooth muscle actin found in enteric tissues. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Based on similarity to peptide cleavage of related actins, the mature protein of this gene is formed by removal of two N-terminal peptides.[provided by RefSeq, Dec 2010]

Uniprot Description

ACTG2: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others. Belongs to the actin family.

Protein type: Cytoskeletal; Contractile; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p13.1

Cellular Component: extracellular space; cytoskeleton; cytosol

Molecular Function: ATP binding

Biological Process: muscle contraction

Disease: Visceral Myopathy

Research Articles on ACTG2

Similar Products

Product Notes

The ACTG2 actg2 (Catalog #AAA6368672) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTG2 (Actin, gamma-enteric Smooth Muscle, Alpha-actin-3, Gamma-2-actin, Smooth Muscle gamma-actin, ACTA3, ACTL3, ACTSG) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACTG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACTG2 actg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACTG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.