Western Blot (WB)
(WB Suggested Anti-Acp2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Kidney)
Rabbit Acp2 Polyclonal Antibody | anti-ACP2 antibody
Acp2 antibody - middle region
Gene Names
Acp2; LAP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Acp2; Polyclonal Antibody; Acp2 antibody - middle region; anti-ACP2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQALRQRYHGFLNASYHRQEVYVRSTDFDRTLMSAEANLAGLFPPTEVQH
Sequence Length
423
Applicable Applications for anti-ACP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Acp2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Kidney)
Western Blot (WB)
(WB Suggested Anti-Acp2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Kidney)
Related Product Information for anti-ACP2 antibody
This is a rabbit polyclonal antibody against Acp2. It was validated on Western Blot
Target Description: Acp2 catalyzes the hydrolysis of p-nitrophenyl phosphate; It may play a role in synaptic transmission.
Target Description: Acp2 catalyzes the hydrolysis of p-nitrophenyl phosphate; It may play a role in synaptic transmission.
Product Categories/Family for anti-ACP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48kDa
NCBI Official Full Name
lysosomal acid phosphatase isoform 1
NCBI Official Synonym Full Names
acid phosphatase 2, lysosomal
NCBI Official Symbol
Acp2
NCBI Official Synonym Symbols
LAP
NCBI Protein Information
lysosomal acid phosphatase
Protein Family
NCBI Description
The protein encoded by this gene belongs to the histidine acid phosphatase family, which hydrolyze orthophosphoric monoesters to alcohol and phosphate. This protein is localized to the lysosomal membrane, and is chemically and genetically distinct from the red cell acid phosphatase. Mice lacking this gene showed multiple defects, including bone structure alterations, lysosomal storage defects, and an increased tendency towards seizures. An enzymatically-inactive allele of this gene showed severe growth retardation, hair-follicle abnormalities, and an ataxia-like phenotype. Two isoforms are predicted to be produced from the same mRNA by the use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. [provided by RefSeq, Oct 2017]
Similar Products
Product Notes
The ACP2 (Catalog #AAA3207663) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Acp2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Acp2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQALRQRYHG FLNASYHRQE VYVRSTDFDR TLMSAEANLA GLFPPTEVQH. It is sometimes possible for the material contained within the vial of "Acp2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
