Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ACOT8Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit ACOT8 Polyclonal Antibody | anti-ACOT8 antibody

ACOT8 Antibody - C-terminal region

Gene Names
ACOT8; hTE; NAP1; PTE1; PTE2; PTE-1; PTE-2; HNAACTE; hACTE-III
Applications
Western Blot
Purity
Affinity purified
Synonyms
ACOT8; Polyclonal Antibody; ACOT8 Antibody - C-terminal region; anti-ACOT8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIK
Sequence Length
35
Applicable Applications for anti-ACOT8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ACOT8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ACOT8Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ACOT8Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ACOT8 antibody
The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells.
Product Categories/Family for anti-ACOT8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
319
NCBI Official Full Name
acyl-coenzyme A thioesterase 8
NCBI Official Synonym Full Names
acyl-CoA thioesterase 8
NCBI Official Symbol
ACOT8
NCBI Official Synonym Symbols
hTE; NAP1; PTE1; PTE2; PTE-1; PTE-2; HNAACTE; hACTE-III
NCBI Protein Information
acyl-coenzyme A thioesterase 8
UniProt Protein Name
Acyl-coenzyme A thioesterase 8
UniProt Gene Name
ACOT8
UniProt Synonym Gene Names
ACTEIII; PTE1; PTE2; Acyl-CoA thioesterase 8; PTE-1; hACTE-III; hACTEIII; hTE
UniProt Entry Name
ACOT8_HUMAN

NCBI Description

The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. [provided by RefSeq, Oct 2010]

Uniprot Description

ACOT8: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May mediate Nef-induced down-regulation of CD4. Major thioesterase in peroxisomes. Competes with BAAT (Bile acid CoA: amino acid N- acyltransferase) for bile acid-CoA substrate (such as chenodeoxycholoyl-CoA). Shows a preference for medium-length fatty acyl-CoAs. May be involved in the metabolic regulation of peroxisome proliferation. Belongs to the C/M/P thioester hydrolase family.

Protein type: EC 3.1.2.27; Hydrolase

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: peroxisomal matrix; mitochondrion

Molecular Function: protein binding; acyl-CoA hydrolase activity; choloyl-CoA hydrolase activity; palmitoyl-CoA hydrolase activity; receptor binding

Biological Process: peroxisome fission; bile acid biosynthetic process; fatty acid beta-oxidation using acyl-CoA oxidase; acyl-CoA metabolic process; viral reproduction; bile acid metabolic process; unsaturated fatty acid metabolic process; cellular lipid metabolic process; dicarboxylic acid catabolic process

Research Articles on ACOT8

Similar Products

Product Notes

The ACOT8 acot8 (Catalog #AAA3222101) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACOT8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACOT8 acot8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HRVAKKLQSG LVWTNCWLIR ELNLPFGGMK SSGIGREGAK DSYDFFTEIK. It is sometimes possible for the material contained within the vial of "ACOT8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.