Rabbit ACOT4 Polyclonal Antibody | anti-ACOT4 antibody
ACOT4 Antibody - middle region
GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH
Target Description: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH By similarity. Succinyl-CoA thioesterase that also hydrolyzes long chain saturated and unsaturated monocarboxylic acyl-CoAs.
NCBI and Uniprot Product Information
Uniprot Description
ACOT4: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Succinyl-CoA thioesterase that also hydrolyzes long chain saturated and unsaturated monocarboxylic acyl-CoAs. Belongs to the C/M/P thioester hydrolase family.
Protein type: EC 3.1.2.2; Lipid Metabolism - unsaturated fatty acid biosynthesis; Hydrolase
Chromosomal Location of Human Ortholog: 14q24.3
Cellular Component: peroxisome
Molecular Function: acyl-CoA hydrolase activity; succinyl-CoA hydrolase activity; palmitoyl-CoA hydrolase activity; receptor binding
Biological Process: dicarboxylic acid metabolic process; acyl-CoA metabolic process; short-chain fatty acid metabolic process; succinyl-CoA metabolic process; very-long-chain fatty acid metabolic process; saturated monocarboxylic acid metabolic process; long-chain fatty acid metabolic process; unsaturated monocarboxylic acid metabolic process; dicarboxylic acid catabolic process; butyrate metabolic process
Research Articles on ACOT4
Similar Products
Product Notes
The ACOT4 acot4 (Catalog #AAA3213875) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACOT4 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACOT4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACOT4 acot4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NALVG GYKNPSMIPI EKAQGPILLI VGQDDHNWRS ELYAQTVSER LQAH. It is sometimes possible for the material contained within the vial of "ACOT4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.
Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.