Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ABI3BPSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Rabbit ABI3BP Polyclonal Antibody | anti-ABI3BP antibody

ABI3BP Antibody - C-terminal region

Gene Names
ABI3BP; TARSH; NESHBP
Reactivity
Tested Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ABI3BP; Polyclonal Antibody; ABI3BP Antibody - C-terminal region; anti-ABI3BP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: PVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKR
Sequence Length
486
Applicable Applications for anti-ABI3BP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABI3BP
Protein Size (#AA)
486 amino acids
Blocking Peptide
For anti-ABI3BP (MBS3208451) antibody is (MBS3233413)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ABI3BPSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ABI3BPSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ABI3BPSample Tissue: Human Thymus TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ABI3BPSample Tissue: Human Thymus TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ABI3BP antibody
This is a rabbit polyclonal antibody against ABI3BP. It was validated on Western Blot

Target Description: ABI3BP contains 2 fibronectin type-III domains. The loss of ABI3BP expression could play a functional role in thyroid tumorigenesis. It also presumably represents a trigger gene for evoking cellular senescence, which has also been suggested to be involved in the prevention of tumorigenesis.
Product Categories/Family for anti-ABI3BP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
target of Nesh-SH3 isoform 5
NCBI Official Synonym Full Names
ABI family member 3 binding protein
NCBI Official Symbol
ABI3BP
NCBI Official Synonym Symbols
TARSH; NESHBP
NCBI Protein Information
target of Nesh-SH3
UniProt Protein Name
Target of Nesh-SH3
Protein Family
UniProt Gene Name
ABI3BP
UniProt Synonym Gene Names
NESHBP; TARSH; Tarsh; NeshBP
UniProt Entry Name
TARSH_HUMAN

Uniprot Description

ABI3BP: 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3q12

Cellular Component: extracellular matrix; extracellular space

Molecular Function: collagen binding; heparin binding

Biological Process: extracellular matrix organization and biogenesis

Research Articles on ABI3BP

Similar Products

Product Notes

The ABI3BP abi3bp (Catalog #AAA3208451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABI3BP Antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ABI3BP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABI3BP abi3bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVSNTVAFST ESADPRVSEP VSAGRDAIWT ERPFNSDSYS ECKGKQYVKR. It is sometimes possible for the material contained within the vial of "ABI3BP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.