Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AATF Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateAATF is supported by BioGPS gene expression data to be expressed in Daudi)

Rabbit AATF Polyclonal Antibody | anti-AATF antibody

AATF antibody - N-terminal region

Gene Names
AATF; DED; BFR2; CHE1; CHE-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
AATF; Polyclonal Antibody; AATF antibody - N-terminal region; anti-AATF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF
Sequence Length
560
Applicable Applications for anti-AATF antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AATF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AATF Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateAATF is supported by BioGPS gene expression data to be expressed in Daudi)

Western Blot (WB) (WB Suggested Anti-AATF Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateAATF is supported by BioGPS gene expression data to be expressed in Daudi)
Related Product Information for anti-AATF antibody
This is a rabbit polyclonal antibody against AATF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The AATF is a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. AATF contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of AATF interfered with MAP3K12 induced apoptosis.The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
protein AATF
NCBI Official Synonym Full Names
apoptosis antagonizing transcription factor
NCBI Official Symbol
AATF
NCBI Official Synonym Symbols
DED; BFR2; CHE1; CHE-1
NCBI Protein Information
protein AATF
UniProt Protein Name
Protein AATF
Protein Family
UniProt Gene Name
AATF
UniProt Synonym Gene Names
CHE1; DED
UniProt Entry Name
AATF_HUMAN

NCBI Description

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq, Jul 2008]

Uniprot Description

AATF: May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dementia), although the molecular basis for this phenomenon has not been described to date. Belongs to the AATF family.

Protein type: RNA-binding; Nucleolus; Transcription factor

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: Golgi apparatus; centrosome; focal adhesion; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; leucine zipper domain binding; transcription factor activity; tau protein binding

Biological Process: nerve growth factor receptor signaling pathway; positive regulation of apoptosis; negative regulation of amyloid precursor protein biosynthetic process; regulation of mitotic cell cycle; ribosome biogenesis and assembly; positive regulation of transcription from RNA polymerase II promoter; negative regulation of superoxide release; cell adhesion; response to DNA damage stimulus; embryonic cleavage; negative regulation of apoptosis

Research Articles on AATF

Similar Products

Product Notes

The AATF aatf (Catalog #AAA3204364) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AATF antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AATF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AATF aatf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAGPQPLALQ LEQLLNPRPS EADPEADPEE ATAARVIDRF DEGEDGEGDF. It is sometimes possible for the material contained within the vial of "AATF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.