Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (VAPB polyclonal antibody. Western Blot analysis of VAPB expression in human placenta.)

Mouse anti-Human VAPB Polyclonal Antibody | anti-VAPB antibody

VAPB (Vesicle-associated Membrane Protein-associated Protein B/C, VAMP-associated Protein B/C, VAMP-B, VAMP-B/VAMP-C, VAP-B, VAP-B/VAP-C, UNQ484/PRO983, ALS8)

Gene Names
VAPB; ALS8; VAP-B; VAMP-B
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
VAPB; Polyclonal Antibody; VAPB (Vesicle-associated Membrane Protein-associated Protein B/C; VAMP-associated Protein B/C; VAMP-B; VAMP-B/VAMP-C; VAP-B; VAP-B/VAP-C; UNQ484/PRO983; ALS8); Anti -VAPB (Vesicle-associated Membrane Protein-associated Protein B/C; anti-VAPB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human VAPB.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Applicable Applications for anti-VAPB antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human VAPB, aa1-243 (NP_004729.1)
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(VAPB polyclonal antibody. Western Blot analysis of VAPB expression in human placenta.)

Western Blot (WB) (VAPB polyclonal antibody. Western Blot analysis of VAPB expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of VAPB expression in transfected 293T cell line by VAPB polyclonal antibody. Lane 1: VAPB transfected lysate (26.73kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VAPB expression in transfected 293T cell line by VAPB polyclonal antibody. Lane 1: VAPB transfected lysate (26.73kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western Blot analysis of VAPB expression in transfected 293T cell line by VAPB polyclonal antibody. Lane 1: VAPB transfected lysate (26.73kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VAPB expression in transfected 293T cell line by VAPB polyclonal antibody. Lane 1: VAPB transfected lysate (26.73kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-VAPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
27,228 Da
NCBI Official Full Name
VAPB
NCBI Official Synonym Full Names
VAMP (vesicle-associated membrane protein)-associated protein B and C
NCBI Official Symbol
VAPB
NCBI Official Synonym Symbols
ALS8; VAP-B; VAMP-B
NCBI Protein Information
vesicle-associated membrane protein-associated protein B/C; VAMP-associated 33 kDa protein
UniProt Protein Name
Vesicle-associated membrane protein-associated protein B/C
UniProt Gene Name
VAPB
UniProt Synonym Gene Names
VAMP-B/VAMP-C; VAMP-associated protein B/C; VAP-B/VAP-C
UniProt Entry Name
VAPB_HUMAN

NCBI Description

The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq, Jul 2008]

Uniprot Description

VAPB: Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation. Defects in VAPB are the cause of amyotrophic lateral sclerosis type 8 (ALS8). ALS8 is a familial form of amyotrophic lateral sclerosis, a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of cases leading to familial forms. Defects in VAPB are a cause of spinal muscular atrophy proximal adult autosomal dominant (SMAPAD); also called late-onset spinal muscular atrophy Finkel type. A form of spinal muscular atrophy, a neuromuscular disorder characterized by degeneration of the anterior horn cells of the spinal cord, leading to symmetrical muscle weakness and atrophy. SMAPAD is characterized by proximal muscle weakness that begins in the lower limbs and then progresses to upper limbs, onset in late adulthood (after third decade) and a benign course. Most of the patients remain ambulatory 10 to 40 years after clinical onset. Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; enzyme binding; protein homodimerization activity; protein heterodimerization activity; FFAT motif binding; microtubule binding; beta-tubulin binding

Biological Process: endoplasmic reticulum organization and biogenesis; cellular calcium ion homeostasis; ER to Golgi vesicle-mediated transport; unfolded protein response, activation of signaling protein activity; sphingolipid metabolic process; positive regulation of viral genome replication; sphingolipid biosynthetic process; unfolded protein response; virus-host interaction; negative regulation of viral protein levels in host cell

Disease: Spinal Muscular Atrophy, Late-onset, Finkel Type; Amyotrophic Lateral Sclerosis 8

Research Articles on VAPB

Similar Products

Product Notes

The VAPB vapb (Catalog #AAA6010024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VAPB (Vesicle-associated Membrane Protein-associated Protein B/C, VAMP-associated Protein B/C, VAMP-B, VAMP-B/VAMP-C, VAP-B, VAP-B/VAP-C, UNQ484/PRO983, ALS8) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VAPB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the VAPB vapb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAKVEQVLSL EPQHELKFRG PFTDVVTTNL KLGNPTDRNV CFKVKTTAPR RYCVRPNSGI IDAGASINVS VMLQPFDYDP NEKSKHKFMV QSMFAPTDTS DMEAVWKEAK PEDLMDSKLR CVFELPAEND KPHDVEINKI ISTTASKTET PIVSKSLSSS LDDTEVKKVM EECKRLQGEV QRLREENKQF KEEDGLRMRK TVQSNSPISA LAPTGKEEGL STRLLALVVL FFIVGVIIGK IAL. It is sometimes possible for the material contained within the vial of "VAPB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.