Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Aacs AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Rabbit Aacs Polyclonal Antibody | anti-AACS antibody

Aacs antibody - middle region

Gene Names
Aacs; SUR5; 2210408B16Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Aacs; Polyclonal Antibody; Aacs antibody - middle region; anti-AACS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKFPGVWAHGDYCRINPK
Sequence Length
672
Applicable Applications for anti-AACS antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Aacs AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Western Blot (WB) (WB Suggested Anti-Aacs AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Related Product Information for anti-AACS antibody
This is a rabbit polyclonal antibody against Aacs. It was validated on Western Blot

Target Description: Aacs activates acetoacetate to acetoacetyl-CoA. It may be involved in utilizing ketone body for the fatty acid-synthesis during adipose tissue development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
acetoacetyl-CoA synthetase
NCBI Official Synonym Full Names
acetoacetyl-CoA synthetase
NCBI Official Symbol
Aacs
NCBI Official Synonym Symbols
SUR5; 2210408B16Rik
NCBI Protein Information
acetoacetyl-CoA synthetase
UniProt Protein Name
Acetoacetyl-CoA synthetase
UniProt Gene Name
Aacs

Uniprot Description

AACS: Activates acetoacetate to acetoacetyl-CoA. May be involved in utilizing ketone body for the fatty acid-synthesis during adipose tissue development. Belongs to the ATP-dependent AMP-binding enzyme family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - butanoate; EC 6.2.1.16; Ligase

Chromosomal Location of Human Ortholog: 5|5 G1.1

Cellular Component: cell; cytoplasm; cytosol

Molecular Function: acetoacetate-CoA ligase activity; ATP binding; butyrate-CoA ligase activity; catalytic activity; ligase activity; nucleotide binding

Biological Process: cellular response to glucose stimulus; fatty acid metabolic process; lipid metabolic process; liver development; metabolic process; positive regulation of insulin secretion; response to drug; response to ethanol; response to nutrient; response to oleate; response to organic cyclic compound; response to organonitrogen compound

Research Articles on AACS

Similar Products

Product Notes

The AACS aacs (Catalog #AAA3214971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Aacs antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Aacs can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AACS aacs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASGELVCTKP IPCQPTHFWN DENGSKYRKA YFSKFPGVWA HGDYCRINPK. It is sometimes possible for the material contained within the vial of "Aacs, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.