Patatin-like phospholipase domain-containing protein 3 (PNPLA3) Recombinant Protein | PNPLA3 recombinant protein
Recombinant Human Patatin-like phospholipase domain-containing protein 3 (PNPLA3), partial
Gene Names
PNPLA3; ADPN; C22orf20; iPLA(2)epsilon
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Patatin-like phospholipase domain-containing protein 3 (PNPLA3); Recombinant Human Patatin-like phospholipase domain-containing protein 3 (PNPLA3); partial; PNPLA3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
63-481. Partial
Sequence
EQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PNPLA3 recombinant protein
This protein is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage
storage in adipocytes.
storage in adipocytes.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,485 Da
NCBI Official Full Name
patatin-like phospholipase domain-containing protein 3
NCBI Official Synonym Full Names
patatin like phospholipase domain containing 3
NCBI Official Symbol
PNPLA3
NCBI Official Synonym Symbols
ADPN; C22orf20; iPLA(2)epsilon
NCBI Protein Information
patatin-like phospholipase domain-containing protein 3
UniProt Protein Name
Patatin-like phospholipase domain-containing protein 3
Protein Family
UniProt Gene Name
PNPLA3
UniProt Synonym Gene Names
ADPN; C22orf20; iPLA2-epsilon
NCBI Description
The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. [provided by RefSeq, Jul 2008]
Uniprot Description
Multifunctional enzyme which has both triacylglycerol lipase and acylglycerol O-acyltransferase activities.
Research Articles on PNPLA3
Similar Products
Product Notes
The PNPLA3 pnpla3 (Catalog #AAA1457879) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 63-481. Partial. The amino acid sequence is listed below: EQTLQVLSDL VRKARSRNIG IFHPSFNLSK FLRQGLCKCL PANVHQLISG KIGISLTRVS DGENVLVSDF RSKDEVVDAL VCSCFIPFYS GLIPPSFRGV RYVDGGVSDN VPFIDAKTTI TVSPFYGEYD ICPKVKSTNF LHVDITKLSL RLCTGNLYLL SRAFVPPDLK VLGEICLRGY LDAFRFLEEK GICNRPQPGL KSSSEGMDPE VAMPSWANMS LDSSPESAAL AVRLEGDELL DHLRLSILPW DESILDTLSP RLATALSEEM KDKGGYMSKI CNLLPIRIMS YVMLPCTLPV ESAIAIVQRL VTWLPDMPDD VLWLQWVTSQ VFTRVLMCLL PASRSQMPVS SQQASPCTPE QDWPCWTPCS PKGCPAETKA EATPRSILRS SLNFFLGNKV PAGAEGLSTF PSFSLEKSL . It is sometimes possible for the material contained within the vial of "Patatin-like phospholipase domain-containing protein 3 (PNPLA3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
