Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human PPM1D Monoclonal Antibody | anti-PPM1D antibody

PPM1D (Protein Phosphatase 1D, Protein Phosphatase 2C Isoform delta, PP2C-delta, Protein Phosphatase Magnesium-dependent 1 delta, p53-induced Protein Phosphatase 1, WIP1) APC

Gene Names
PPM1D; WIP1; PP2C-DELTA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPM1D; Monoclonal Antibody; PPM1D (Protein Phosphatase 1D; Protein Phosphatase 2C Isoform delta; PP2C-delta; Protein Phosphatase Magnesium-dependent 1 delta; p53-induced Protein Phosphatase 1; WIP1) APC; anti-PPM1D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D1
Specificity
Recognizes human PPM1D.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PPM1D antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa496-605 from PPM1D (NP_003611) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of PPM1D expression in transfected 293T cell line by PPM1D monoclonal antibody Lane 1: PPM1D transfected lysate (66.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPM1D expression in transfected 293T cell line by PPM1D monoclonal antibody Lane 1: PPM1D transfected lysate (66.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PPM1D is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPM1D is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-PPM1D antibody
PPM1D is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. Expression of this PPM1D gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. The PPM1D gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development.
Product Categories/Family for anti-PPM1D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 67 kDa

Observed: 68 kDa
NCBI Official Full Name
protein phosphatase 1D
NCBI Official Synonym Full Names
protein phosphatase, Mg2+/Mn2+ dependent, 1D
NCBI Official Symbol
PPM1D
NCBI Official Synonym Symbols
WIP1; PP2C-DELTA
NCBI Protein Information
protein phosphatase 1D; protein phosphatase Wip1; wild-type p53-induced phosphatase 1; protein phosphatase 2C delta isoform; protein phosphatase 1D magnesium-dependent, delta isoform
UniProt Protein Name
Protein phosphatase 1D
Protein Family
UniProt Gene Name
PPM1D
UniProt Synonym Gene Names
WIP1; PP2C-delta
UniProt Entry Name
PPM1D_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. The expression of this gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. This gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development. [provided by RefSeq, Jul 2008]

Uniprot Description

PPM1D: a magnesium-dependent Ser/Thr phosphatase. A p53-induced phosphatase that interacts with the nuclear isoform of uracil DNA glycosylase, UNG2, and suppresses base excision repair. Might contribute to growth inhibitory pathways activated in response to DNA damage in a p53-dependent manner.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; Cell cycle regulation; EC 3.1.3.16; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 17q23.2

Cellular Component: nucleus

Molecular Function: protein binding; metal ion binding; protein serine/threonine phosphatase activity

Biological Process: negative regulation of cell proliferation; response to radiation; response to bacterium; G2/M transition of mitotic cell cycle; protein amino acid dephosphorylation

Disease: Breast Cancer

Research Articles on PPM1D

Similar Products

Product Notes

The PPM1D ppm1d (Catalog #AAA6138392) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPM1D (Protein Phosphatase 1D, Protein Phosphatase 2C Isoform delta, PP2C-delta, Protein Phosphatase Magnesium-dependent 1 delta, p53-induced Protein Phosphatase 1, WIP1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPM1D can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPM1D ppm1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPM1D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.