Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human uPAR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 42 kDa.)

uPAR recombinant protein

Recombinant Human uPAR Protein

Gene Names
PLAUR; CD87; UPAR; URKR; U-PAR
Purity
>97% by SDS-PAGE.
Synonyms
uPAR; Recombinant Human uPAR Protein; CD87; U-PAR; UPAR; URKR; uPAR recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYR
Sequence Length
335
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human uPAR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 42 kDa.)

SDS-Page (Recombinant Human uPAR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 42 kDa.)
Related Product Information for uPAR recombinant protein
Description: Recombinant Human uPAR Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Arg303) of human uPAR (Accession #NP_002650.1) fused with a 6xHis tag at the C-terminus.

Background: The secreted recombinant human UPAR consists of 292 amino acids with a molecular weight of 32.8 kDa. Recombinant human UPAR migrates as an about 48 kDa band in SDS-PAGE under reducing conditions due to glycosylation.Urokinase plasminogen activator surface receptor (U-PAR) is also known as PLAUR, Monocyte activation antigen Mo3, CD antigen CD87. U-PAR contains three UPAR/Ly6 domains and is expressed in neurons of the rolandic area of the brain (at protein level). PLAUR / UPAR acts as a receptor for urokinase plasminogen activator and plays a role in localizing and promoting plasmin formation. Urokinase plasminogen activator (uPA) and/or its receptor (uPAR) are essential for metastasis, and overexpression of these molecules is strongly correlated with poor prognosis in a variety of malignant tumours. Furthermore, the analysis of U-PAR expression has a potential role in the test or prognostic work-up of several hematological malignancies, particularly acute leukemia and multiple myeloma.
Product Categories/Family for uPAR recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
urokinase plasminogen activator surface receptor isoform 1
NCBI Official Synonym Full Names
plasminogen activator, urokinase receptor
NCBI Official Symbol
PLAUR
NCBI Official Synonym Symbols
CD87; UPAR; URKR; U-PAR
NCBI Protein Information
urokinase plasminogen activator surface receptor
UniProt Protein Name
Urokinase plasminogen activator surface receptor
UniProt Gene Name
PLAUR
UniProt Synonym Gene Names
MO3; UPAR; U-PAR; uPAR
UniProt Entry Name
UPAR_HUMAN

NCBI Description

This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq, Jul 2008]

Uniprot Description

uPAR: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form. Monomer (Probable). Interacts with MRC2. Interacts (via the UPAR/Ly6 domains) with SRPX2. Expressed in neurons of the rolandic area of the brain. Expressed in the brain. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, GPI anchor; Receptor, misc.

Chromosomal Location of Human Ortholog: 19q13

Cellular Component: endoplasmic reticulum membrane; extrinsic to membrane; focal adhesion; integral to plasma membrane; endoplasmic reticulum lumen; integral to membrane; plasma membrane

Molecular Function: protein domain specific binding; protein binding; U-plasminogen activator receptor activity; enzyme binding; receptor activity; receptor binding

Biological Process: fibrinolysis; cellular protein metabolic process; attachment of GPI anchor to protein; regulation of proteolysis; C-terminal protein lipidation; chemotaxis; post-translational protein modification; cell motility; blood coagulation; signal transduction

Research Articles on uPAR

Similar Products

Product Notes

The uPAR plaur (Catalog #AAA9141832) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LRCMQCKTNG DCRVEECALG QDLCRTTIVR LWEEGEELEL VEKSCTHSEK TNRTLSYRTG LKITSLTEVV CGLDLCNQGN SGRAVTYSRS RYLECISCGS SDMSCERGRH QSLQCRSPEE QCLDVVTHWI QEGEEGRPKD DRHLRGCGYL PGCPGSNGFH NNDTFHFLKC CNTTKCNEGP ILELENLPQN GRQCYSCKGN STHGCSSEET FLIDCRGPMN QCLVATGTHE PKNQSYMVRG CATASMCQHA HLGDAFSMNH IDVSCCTKSG CNHPDLDVQY R. It is sometimes possible for the material contained within the vial of "uPAR, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.