Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Secreted Phospholipase A2-IID Recombinant Protein | PLA2G2D recombinant protein

Recombinant Human Secreted Phospholipase A2-IID

Gene Names
PLA2G2D; SPLASH; sPLA2S; PLA2IID; sPLA2-IID
Synonyms
Secreted Phospholipase A2-IID; Recombinant Human Secreted Phospholipase A2-IID; PLA2G2D Human; Secreted Phospholipase A2-IID Human Recombinant; Group IID secretory phospholipase A2; EC 3.1.1.4; Phosphatidylcholine 2-acylhydrolase GIID; GIID sPLA2; PLA2IID; sPLA(2)-IID; Secretory-type PLA; stroma-associated homolog; SPLASH; sPLA2S; PLA2G2D; PLA2G2D recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Form/Format
Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
Sterile Filtered lyophilized (freeze-dried) powder.
Sequence
MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Sequence Length
62
Solubility
Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 ug/ml. In higher concentrations the solubility of this antigen is limited.
Preparation and Storage
Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.
Related Product Information for PLA2G2D recombinant protein
Description: Secreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues His-Tag (underlined).

Introduction: Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large: small ratio of surfactant aggregates in rats.
Product Categories/Family for PLA2G2D recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,546 Da
NCBI Official Full Name
group IID secretory phospholipase A2 isoform 2
NCBI Official Synonym Full Names
phospholipase A2, group IID
NCBI Official Symbol
PLA2G2D
NCBI Official Synonym Symbols
SPLASH; sPLA2S; PLA2IID; sPLA2-IID
NCBI Protein Information
group IID secretory phospholipase A2; GIID sPLA2; phosphatidylcholine 2-acylhydrolase 2D; secretory phospholipase A2s; secretory-type PLA, stroma-associated homolog
UniProt Protein Name
Group IID secretory phospholipase A2
UniProt Gene Name
PLA2G2D
UniProt Synonym Gene Names
SPLASH; GIID sPLA2; sPLA2-IID
UniProt Entry Name
PA2GD_HUMAN

NCBI Description

This gene encodes a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophospholipids and free fatty acid. This gene may be involved in inflammation and immune response, and in weight loss associated with chronic obstructive pulmonary disease. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2012]

Uniprot Description

PLA2G2D: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. L-alpha-1-palmitoyl-2- linoleoyl phosphatidylethanolamine is more efficiently hydrolyzed than the other phospholipids examined. Belongs to the phospholipase A2 family.

Protein type: Lipid Metabolism - arachidonic acid; Secreted, signal peptide; Lipid Metabolism - ether lipid; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - linoleic acid; Phospholipase; Secreted; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4

Chromosomal Location of Human Ortholog: 1p36.12

Cellular Component: extracellular region

Molecular Function: phospholipase A2 activity; calcium ion binding

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; inflammatory response; lipid catabolic process

Research Articles on PLA2G2D

Similar Products

Product Notes

The PLA2G2D pla2g2d (Catalog #AAA142467) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MRGSHHH HHHGMASHM< /u>GILNLNK MVKQVTGKMP ILSYWPYGCH CGLGGR GQPKDATDWC CQTHDCCYDH LKTQGCGIYK YYRYNFSQGN IHCSDKGSWC EQQLCACDKE VAFCLKRNLD TYQKRLRFYW RPHCRGQTPG C. It is sometimes possible for the material contained within the vial of "Secreted Phospholipase A2-IID, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.