3-hydroxyacyl-CoA dehydratase PHS1 (PHS1) Recombinant Protein | PHS1 recombinant protein
Recombinant Saccharomyces cerevisiae 3-hydroxyacyl-CoA dehydratase PHS1 (PHS1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-hydroxyacyl-CoA dehydratase PHS1 (PHS1); Recombinant Saccharomyces cerevisiae 3-hydroxyacyl-CoA dehydratase PHS1 (PHS1); Recombinant 3-hydroxyacyl-CoA dehydratase PHS1 (PHS1); 3-hydroxyacyl-CoA dehydratase PHS1; HACD EC= 4.2.1.-; PTPLA homolog involved in sphingolipid biosynthesis protein 1; PHS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-217
Sequence
MSKKLASPLSFLPLYNLLSAVGWSYLLYLVISLYPKVGQPAFFYQTKNVATLVQCGAIIEIINSFLGVVRSPLLTTVAQVSSRLLVVLGIFQLLPNTSGVQSVVYISLLLAWSITEIVRYLYYFFMLVFKNGAPKILILLRYNLFWILYPTGVASELRIIYCALNAAESQYSLLYKRILIAAMLAYIPGFPMLFLHMVAQRKKVMKSLRSSFGKKLI
Sequence Length
217
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,511 Da
NCBI Official Full Name
Phs1p
NCBI Official Symbol
PHS1
NCBI Protein Information
Phs1p
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PHS1
Protein Family
UniProt Gene Name
PHS1
UniProt Synonym Gene Names
HACD
UniProt Entry Name
PHS1_YEAST
Uniprot Description
Function: Responsible for the dehydration step in very long-chain fatty acids (VLCFAs) synthesis. Ref.7 Ref.8
Catalytic activity: A very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] = a very-long-chain trans-2,3-dehydroacyl-[acyl-carrier protein] + H2O. Ref.7 Ref.8
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein Ref.5 Ref.8.
Sequence similarities: Belongs to the very long-chain fatty acids dehydratase HACD family.
Research Articles on PHS1
Similar Products
Product Notes
The PHS1 phs1 (Catalog #AAA1178763) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-217. The amino acid sequence is listed below: MSKKLASPLS FLPLYNLLSA VGWSYLLYLV ISLYPKVGQP AFFYQTKNVA TLVQCGAIIE IINSFLGVVR SPLLTTVAQV SSRLLVVLGI FQLLPNTSGV QSVVYISLLL AWSITEIVRY LYYFFMLVFK NGAPKILILL RYNLFWILYP TGVASELRII YCALNAAESQ YSLLYKRILI AAMLAYIPGF PMLFLHMVAQ RKKVMKSLRS SFGKKLI. It is sometimes possible for the material contained within the vial of "3-hydroxyacyl-CoA dehydratase PHS1 (PHS1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
