Prohibitin-2 (Phb2) Recombinant Protein | Phb2 recombinant protein
Recombinant Mouse Prohibitin-2 (Phb2)
Gene Names
Phb2; BAP; REA; Bap37; Bcap37; AU044498
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prohibitin-2 (Phb2); Recombinant Mouse Prohibitin-2 (Phb2); Phb2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-299, Full length protein
Sequence
AQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Sequence Length
298
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,296 Da
NCBI Official Full Name
prohibitin-2
NCBI Official Synonym Full Names
prohibitin 2
NCBI Official Symbol
Phb2
NCBI Official Synonym Symbols
BAP; REA; Bap37; Bcap37; AU044498
NCBI Protein Information
prohibitin-2
UniProt Protein Name
Prohibitin-2
Protein Family
UniProt Gene Name
Phb2
Uniprot Description
Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.
Research Articles on Phb2
Similar Products
Product Notes
The Phb2 phb2 (Catalog #AAA1037998) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-299, Full length protein. The amino acid sequence is listed below: AQNLKDLAGR LPAGPRGMGT ALKLLLGAGA VAYGVRESVF TVEGGHRAIF FNRIGGVQQD TILAEGLHFR IPWFQYPIIY DIRARPRKIS SPTGSKDLQM VNISLRVLSR PNAQELPSMY QRLGLDYEER VLPSIVNEVL KSVVAKFNAS QLITQRAQVS LLIRRELTER AKDFSLILDD VAITELSFSR EYTAAVEAKQ VAQQEAQRAQ FLVEKAKQEQ RQKIVQAEGE AEAAKMLGEA LSKNPGYIKL RKIRAAQNIS KTIATSQNRI YLTADNLVLN LQDESFTRGS DSLIKGKK. It is sometimes possible for the material contained within the vial of "Prohibitin-2 (Phb2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
