SDS-PAGE
Prohibitin-2 (PHB2) Recombinant Protein | PHB2 recombinant protein
Recombinant Human Prohibitin-2 (PHB2)
Gene Names
PHB2; BAP; REA; p22; Bap37; BCAP37; PNAS-141
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prohibitin-2 (PHB2); Recombinant Human Prohibitin-2 (PHB2); Prohibitin-2; B-cell receptor-associated protein BAP37; D-prohibitin; Repressor of estrogen receptor activity; PHB2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-299aa; Full Length
Sequence
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for PHB2 recombinant protein
Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.
Product Categories/Family for PHB2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60.2 kDa
NCBI Official Full Name
prohibitin-2 isoform 1
NCBI Official Synonym Full Names
prohibitin 2
NCBI Official Symbol
PHB2
NCBI Official Synonym Symbols
BAP; REA; p22; Bap37; BCAP37; PNAS-141
NCBI Protein Information
prohibitin-2; D-prohibitin; B-cell associated protein; repressor of estrogen receptor activity; B-cell receptor-associated protein BAP37
UniProt Protein Name
Prohibitin-2
Protein Family
UniProt Gene Name
PHB2
UniProt Synonym Gene Names
BAP; REA
UniProt Entry Name
PHB2_HUMAN
Uniprot Description
BAP37: a protein of the band 7 family. This family includes the prohibitins, cytoplasmic anti-proliferative proteins and stomatin, an erythrocyte membrane protein. A repressor of estrogen receptor (ER) activity. Reverses steroid receptor coactivator 1 enhancement of ER activity. May play a role in determining the sensitivity of estrogen target cells to antiestrogen and estrogen therapy.
Protein type: Mitochondrial; Nuclear receptor co-regulator; Transcription, coactivator/corepressor
Chromosomal Location of Human Ortholog: 12p13
Cellular Component: protein complex; nuclear matrix; mitochondrion; mitochondrial inner membrane; nucleus
Molecular Function: protein binding; estrogen receptor binding
Biological Process: transcription, DNA-dependent; negative regulation of transcription, DNA-dependent; negative regulation of mammary gland epithelial cell proliferation; negative regulation of estrogen receptor signaling pathway
Research Articles on PHB2
Similar Products
Product Notes
The PHB2 phb2 (Catalog #AAA1282243) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-299aa; Full Length. The amino acid sequence is listed below: MAQNLKDLAG RLPAGPRGMG TALKLLLGAG AVAYGVRESV FTVEGGHRAI FFNRIGGVQQ DTILAEGLHF RIPWFQYPII YDIRARPRKI SSPTGSKDLQ MVNISLRVLS RPNAQELPSM YQRLGLDYEE RVLPSIVNEV LKSVVAKFNA SQLITQRAQV SLLIRRELTE RAKDFSLILD DVAITELSFS REYTAAVEAK QVAQQEAQRA QFLVEKAKQE QRQKIVQAEG EAEAAKMLGE ALSKNPGYIK LRKIRAAQNI SKTIATSQNR IYLTADNLVL NLQDESFTRG SDSLIKGKK . It is sometimes possible for the material contained within the vial of "Prohibitin-2 (PHB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
