Post-GPI attachment to proteins factor 3 (PGAP3) Recombinant Protein | PGAP3 recombinant protein

Recombinant Human Post-GPI attachment to proteins factor 3 (PGAP3)

Cat. Num. AAA7026076

• Gene Names: PGAP3; CAB2; PERLD1; PP1498; hCOS16; AGLA546
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Post-GPI attachment to proteins factor 3 (PGAP3); Recombinant Human Post-GPI attachment to proteins factor 3 (PGAP3); PGAP3 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 21-320aa; full length protein
• Sequence: SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLY LQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCV AFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFR ALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVV LLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEDKFKLD
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for PGAP3 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 619726944
• NCBI GeneID: 93210
• NCBI Accession #: NP_001278655.1
• NCBI GenBank Nucleotide #: NM_001291726.1
• UniProt Accession #: Q96FM1; Q86Z03; Q8NBJ8; B4DGK7
• Molecular Weight: 33,967 Da
• NCBI Official Full Name: post-GPI attachment to proteins factor 3 isoform 2
• NCBI Official Synonym Full Names: post-GPI attachment to proteins 3
• NCBI Official Symbol: PGAP3
• NCBI Official Synonym Symbols: CAB2; PERLD1; PP1498; hCOS16; AGLA546
• NCBI Protein Information: post-GPI attachment to proteins factor 3
• UniProt Protein Name: Post-GPI attachment to proteins factor 3
• Protein Family: Post-GPI attachment to proteins factor
• UniProt Gene Name: PGAP3
• UniProt Synonym Gene Names: CAB2; PERLD1; hCOS16
• UniProt Entry Name: PGAP3_HUMAN

NCBI Description

This gene encodes a glycosylphosphatidylinositol (GPI)-specific phospholipase that primarily localizes to the Golgi apparatus. This ubiquitously expressed gene is predicted to encode a seven-transmembrane protein that removes unsaturated fatty acids from the sn-2 position of GPI. The remodeling of the constituent fatty acids on GPI is thought to be important for the proper association between GPI-anchored proteins and lipid rafts. The tethering of proteins to plasma membranes via posttranslational GPI-anchoring is thought to play a role in protein sorting and trafficking. Mutations in this gene cause the autosomal recessive neurologic disorder hyperphosphatasia with mental retardation syndrome 4 (HPMRS4). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2014]

Uniprot Description

PGAP3: Involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins. Required for phospholipase A2 activity that removes an acyl-chain at the sn-2 position of GPI-anchors during the remodeling of GPI (Probable). Belongs to the PGAP3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: Golgi membrane; integral to membrane; intrinsic to endoplasmic reticulum membrane

Molecular Function: hydrolase activity, acting on ester bonds

Biological Process: GPI anchor biosynthetic process; GPI anchor metabolic process

Disease: Hyperphosphatasia With Mental Retardation Syndrome 4