SDS-PAGE
PDZ domain-containing protein 11 Recombinant Protein | PDZD11 recombinant protein
Recombinant Human PDZ domain-containing protein 11
Gene Names
PDZD11; PISP; AIPP1; PDZK11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
PDZ domain-containing protein 11; Recombinant Human PDZ domain-containing protein 11; ATPase-interacting PDZ protein; Plasma membrane calcium ATPase-interacting single-PDZ protein; PMCA-interacting single-PDZ protein; PDZD11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-140aa; Full Length
Sequence
MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
Sequence Length
140
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for PDZD11 recombinant protein
References
Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X., Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32.1 kDa
NCBI Official Full Name
PDZ domain-containing protein 11
NCBI Official Synonym Full Names
PDZ domain containing 11
NCBI Official Symbol
PDZD11
NCBI Official Synonym Symbols
PISP; AIPP1; PDZK11
NCBI Protein Information
PDZ domain-containing protein 11
UniProt Protein Name
PDZ domain-containing protein 11
Protein Family
UniProt Gene Name
PDZD11
UniProt Synonym Gene Names
AIPP1; PDZK11; PISP; PMCA-interacting single-PDZ protein
UniProt Entry Name
PDZ11_HUMAN
Uniprot Description
PDZD11: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: Xq13.1
Cellular Component: basolateral plasma membrane; cytosol; extracellular region; intercellular junction; synapse
Molecular Function: protein binding; protein C-terminus binding
Biological Process: biotin metabolic process; exocytosis; maintenance of epithelial cell polarity; neurotransmitter secretion; pantothenate metabolic process; transmembrane transport; vitamin metabolic process; water-soluble vitamin metabolic process
Research Articles on PDZD11
Similar Products
Product Notes
The PDZD11 pdzd11 (Catalog #AAA1371177) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-140aa; Full Length. The amino acid sequence is listed below: MDSRIPYDDY PVVFLPAYEN PPAWIPPHER VHHPDYNNEL TQFLPRTITL KKPPGAQLGF NIRGGKASQL GIFISKVIPD SDAHRAGLQE GDQVLAVNDV DFQDIEHSKA VEILKTAREI SMRVRFFPYN YHRQKERTVH. It is sometimes possible for the material contained within the vial of "PDZ domain-containing protein 11, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
