Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Zinc finger protein 592 Recombinant Protein | ZNF592 recombinant protein

Recombinant Human Zinc finger protein 592

Gene Names
ZNF592; CAMOS; SCAR5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein 592; Recombinant Human Zinc finger protein 592; ZNF592 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-242aa; Partial
Sequence
MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL
Sequence Length
1267
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for ZNF592 recombinant protein
May be involved in transcriptional regulation.
Product Categories/Family for ZNF592 recombinant protein
References
Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.DNA Res. 3:321-329(1996)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.2 kDa
NCBI Official Full Name
zinc finger protein 592
NCBI Official Synonym Full Names
zinc finger protein 592
NCBI Official Symbol
ZNF592
NCBI Official Synonym Symbols
CAMOS; SCAR5
NCBI Protein Information
zinc finger protein 592
UniProt Protein Name
Zinc finger protein 592
Protein Family
UniProt Gene Name
ZNF592
UniProt Synonym Gene Names
KIAA0211
UniProt Entry Name
ZN592_HUMAN

NCBI Description

This gene is thought to play a role in a complex developmental pathway and the regulation of genes involved in cerebellar development. Mutations in this gene have been associated with autosomal recessive spinocerebellar ataxia. [provided by RefSeq, Jan 2011]

Uniprot Description

ZNF592: a probable transcriptional regulator of the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 15q25.3

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; protein binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Disease: Spinocerebellar Ataxia, Autosomal Recessive 5

Research Articles on ZNF592

Similar Products

Product Notes

The ZNF592 znf592 (Catalog #AAA717326) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-242aa; Partial. The amino acid sequence is listed below: MGDMKTPDFD DLLAAFDIPD PTSLDAKEAI QTPSEENESP LKPPGICMDE SVSLSHSGSA PDVPAVSVIV KNTSRQESFE AEKDHITPSL LHNGFRGSDL PPDPHNCGKF DSTFMNGDSA RSFPGKLEPP KSEPLPTFNQ FSPISSPEPE DPIKDNGFGI KPKHSDSYFP PPLGCGAVGG PVLEALAKFP VPELHMFDHF CKKEPKPEPL PLGSQQEHEQ SGQNTVEPHK DPDATRFFGE AL. It is sometimes possible for the material contained within the vial of "Zinc finger protein 592, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.