Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Pyridoxal kinase (PDXK) Recombinant Protein | PDXK recombinant protein

Recombinant Human Pyridoxal kinase (PDXK)

Gene Names
PDXK; PKH; PNK; PRED79; C21orf97; HEL-S-1a; C21orf124
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pyridoxal kinase (PDXK); Recombinant Human Pyridoxal kinase (PDXK); Pyridoxal kinase; EC=2.7.1.35; Pyridoxine kinase; PDXK recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-312aa; Full Length
Sequence
MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Sequence Length
312
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for PDXK recombinant protein
Required for synthesis of pyridoxal-5-phosphate from vitamin B6.
Product Categories/Family for PDXK recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62.1 kDa
NCBI Official Full Name
pyridoxal kinase
NCBI Official Synonym Full Names
pyridoxal (pyridoxine, vitamin B6) kinase
NCBI Official Symbol
PDXK
NCBI Official Synonym Symbols
PKH; PNK; PRED79; C21orf97; HEL-S-1a; C21orf124
NCBI Protein Information
pyridoxal kinase; pyridoxine kinase; vitamin B6 kinase; pyridoxamine kinase; epididymis secretory sperm binding protein Li 1a
UniProt Protein Name
Pyridoxal kinase
Protein Family
UniProt Gene Name
PDXK
UniProt Synonym Gene Names
C21orf124; C21orf97; PKH; PNK
UniProt Entry Name
PDXK_HUMAN

NCBI Description

The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PDXK: Required for synthesis of pyridoxal-5-phosphate from vitamin B6. Belongs to the pyridoxine kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cofactor and Vitamin Metabolism - vitamin B6; EC 2.7.1.35; Kinase, other

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: potassium ion binding; sodium ion binding; protein homodimerization activity; zinc ion binding; pyridoxal kinase activity; magnesium ion binding; lithium ion binding; ATP binding; pyridoxal phosphate binding

Biological Process: cell proliferation; vitamin B6 metabolic process; vitamin metabolic process; pyridoxal 5'-phosphate salvage; phosphorylation; water-soluble vitamin metabolic process; pyridoxal phosphate biosynthetic process

Research Articles on PDXK

Similar Products

Product Notes

The PDXK pdxk (Catalog #AAA1130956) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-312aa; Full Length. The amino acid sequence is listed below: MEEECRVLSI QSHVIRGYVG NRAATFPLQV LGFEIDAVNS VQFSNHTGYA HWKGQVLNSD ELQELYEGLR LNNMNKYDYV LTGYTRDKSF LAMVVDIVQE LKQQNPRLVY VCDPVLGDKW DGEGSMYVPE DLLPVYKEKV VPLADIITPN QFEAELLSGR KIHSQEEALR VMDMLHSMGP DTVVITSSDL PSPQGSNYLI VLGSQRRRNP AGSVVMERIR MDIRKVDAVF VGTGDLFAAM LLAWTHKHPN NLKVACEKTV STLHHVLQRT IQCAKAQAGE GVRPSPMQLE LRMVQSKRDI EDPEIVVQAT VL. It is sometimes possible for the material contained within the vial of "Pyridoxal kinase (PDXK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.