Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Nucleoside diphosphate kinase, mitochondrial (NME4) Recombinant Protein | NME4 recombinant protein

Recombinant Human Nucleoside diphosphate kinase, mitochondrial (NME4)

Gene Names
NME4; NDPK-D; NM23H4; nm23-H4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleoside diphosphate kinase; mitochondrial (NME4); Recombinant Human Nucleoside diphosphate kinase; mitochondrial; NDK; NDP kinase; EC=2.7.4.6; Nucleoside diphosphate kinase D; NDPKD; nm23-H4; NME4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-187aa; Full Length
Sequence
SWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Sequence Length
154
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for NME4 recombinant protein
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis. Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity. Acts as mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration. Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria. In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling.
Product Categories/Family for NME4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44.3 kDa
NCBI Official Full Name
nucleoside diphosphate kinase, mitochondrial isoform b
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 4
NCBI Official Symbol
NME4
NCBI Official Synonym Symbols
NDPK-D; NM23H4; nm23-H4
NCBI Protein Information
nucleoside diphosphate kinase, mitochondrial; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; non-metastatic cells 4, protein expressed in
UniProt Protein Name
Nucleoside diphosphate kinase, mitochondrial
UniProt Gene Name
NME4
UniProt Synonym Gene Names
NM23D; NDK; NDP kinase, mitochondrial; NDPKD
UniProt Entry Name
NDKM_HUMAN

NCBI Description

The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]

Uniprot Description

NME4: Major role in the synthesis of nucleoside triphosphates other than ATP. Belongs to the NDK family.

Protein type: EC 2.7.4.6; Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; Mitochondrial; Kinase, other; Kinase, nucleoside diphosphate; Other group; NDK family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; cytosol

Molecular Function: protein binding; metal ion binding; protein complex binding; nucleoside diphosphate kinase activity; ATP binding

Biological Process: GTP biosynthetic process; regulation of apoptosis; CTP biosynthetic process; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleotide metabolic process; UTP biosynthetic process; nucleoside triphosphate biosynthetic process; nucleoside metabolic process; nucleoside diphosphate phosphorylation; purine nucleotide metabolic process

Research Articles on NME4

Similar Products

Product Notes

The NME4 nme4 (Catalog #AAA1094952) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-187aa; Full Length. The amino acid sequence is listed below: SWTRERTLVA VKPDGVQRRL VGDVIQRFER RGFTLVGMKM LQAPESVLAE HYQDLRRKPF YPALIRYMSS GPVVAMVWEG YNVVRASRAM IGHTDSAEAA PGTIRGDFSV HISRNVIHAS DSVEGAQREI QLWFQSSELV SWADGGQHSS IHPA. It is sometimes possible for the material contained within the vial of "Nucleoside diphosphate kinase, mitochondrial (NME4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.