Calcitonin receptor-like protein 1 (pdfr-1) Recombinant Protein | pdfr-1 recombinant protein
Recombinant Calcitonin receptor-like protein 1 (pdfr-1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcitonin receptor-like protein 1 (pdfr-1); Recombinant Calcitonin receptor-like protein 1 (pdfr-1); pdfr-1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-546aa; full length protein
Sequence
MADATSPFNVSILDNSTKLSEMVESGWNVLASTSVQAFNEAMDVLEESYPLCKKMLDHNN LFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVSGVWS GRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLV SLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGK TINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIP LVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSK VRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMY QGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKNGTANASAP QTNNADEFGKLSPFPSRSKKGSDDSTTKLMKDAVMEEEKNANNNGYGSAGEMTPLREGSN RSTKSP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Caenorhabditis elegans
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for pdfr-1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,895 Da
NCBI Official Full Name
Calcitonin receptor-like protein 1
NCBI Official Symbol
pdfr-1
NCBI Protein Information
Calcitonin receptor-like protein 1; PDF Receptor homolog
UniProt Protein Name
Calcitonin receptor-like protein 1
Protein Family
UniProt Gene Name
pdfr-1
UniProt Synonym Gene Names
seb-1
UniProt Entry Name
PDFR1_CAEEL
Uniprot Description
G-protein coupled receptor for PDF neuropeptides. Activated by peptides PDF-1 and PDF-2 but to a lesser extent with isoform c. Isoforms a and b are thought to act through the G-alpha(s) type of G proteins to elevate cAMP levels whereas isoform c inhibits cAMP levels through the G-alpha(i/o) type of G proteins. Involved in locomotion; more specifically mate searching behavior independent of nutritional status. Might have a role in touch sensitivity.
Research Articles on pdfr-1
Similar Products
Product Notes
The pdfr-1 pdfr-1 (Catalog #AAA7025457) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-546aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the pdfr-1 pdfr-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADATSPFNV SILDNSTKLS EMVESGWNVL ASTSVQAFNE AMDVLEESYP LCKKMLDHNN LFPERDPNDT RIWCNATYDT VLCWPPTPAN SSVTLQCPHM KGLDPNKNIT KDCHVSGVWS GRNAGEMGPT LPGWTNFTMC YTDEVIYIMQ NLNNESLTIA QEVARNARKL EFVGLGLSLV SLILAISIFS YFRRLRVFRN LLHLHLMIAM LMVVILRLVL YIDLIFTGEN GPHTNSAEGK TINTMPIVCE GMFFFLEYFK TVTFCWMFLE GIYLNNQIVF GFFNSEPKLL PYFIAGYGIP LVHTMLWLLV VLIKKDFKVE RCLGSYYLEP EFWILDGPRM AELVINLFFI CNVIRVLYSK VRESNNTSEA GLKKSVKAAM MLLPLLGVPN IMQTIPFAPT RDNIMVFAVW TYTASFTYMY QGLMVASIYC FTNKEVNHVL KTFYARYRLL HKSQNELRRG SRSVASHYAA KNGTANASAP QTNNADEFGK LSPFPSRSKK GSDDSTTKLM KDAVMEEEKN ANNNGYGSAG EMTPLREGSN RSTKSP. It is sometimes possible for the material contained within the vial of "Calcitonin receptor-like protein 1 (pdfr-1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
