Proprotein convertase subtilisin/kexin type 6 (Pcsk6) Recombinant Protein | Pcsk6 recombinant protein
Recombinant Rat Proprotein convertase subtilisin/kexin type 6 (Pcsk6) , partial
Gene Names
Pcsk6; Spc4; Pace4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proprotein convertase subtilisin/kexin type 6 (Pcsk6); Recombinant Rat Proprotein convertase subtilisin/kexin type 6 (Pcsk6); partial; Pcsk6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
181-468. Partial, covers the Peptidase S8 Domain
Sequence
VVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGLVDAEALV
Sequence Length
468
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pcsk6 recombinant protein
This protein belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104,053 Da
NCBI Official Full Name
proprotein convertase subtilisin/kexin type 6
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 6
NCBI Official Symbol
Pcsk6
NCBI Official Synonym Symbols
Spc4; Pace4
NCBI Protein Information
proprotein convertase subtilisin/kexin type 6
UniProt Protein Name
Proprotein convertase subtilisin/kexin type 6
Protein Family
UniProt Gene Name
Pcsk6
UniProt Synonym Gene Names
Pace4; SPC4
NCBI Description
may play a role in neuroendocrine peptide processing [RGD, Feb 2006]
Uniprot Description
Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues.
Research Articles on Pcsk6
Similar Products
Product Notes
The Pcsk6 pcsk6 (Catalog #AAA1446817) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 181-468. Partial, covers the Peptidase S8 Domain. The amino acid sequence is listed below: VVTILDDGIE RNHPDLAPNY DSYASYDVNG NDYDPSPRYD ASNENKHGTR CAGEVAASAN NSYCIVGIAY NAKIGGIRML DGDVTDVVEA KSLGIRPNYI DIYSASWGPD DDGKTVDGPG RLAKQAFEYG IKKGRQGLGS IFVWASGNGG REGDHCSCDG YTNSIYTISV SSTTENGHKP WYLEECASTL ATTYSSGAFY ERKIVTTDLR QRCTDGHTGT SVSAPMVAGI IALALEANNQ LTWRDVQHLL VKTSRPAHLK ASDWKVNGAG HKVSHLYGFG LVDAEALV . It is sometimes possible for the material contained within the vial of "Proprotein convertase subtilisin/kexin type 6 (Pcsk6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
