Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in mouse liver.)

Rabbit SFRP3 Polyclonal Antibody | anti-SFRP3 antibody

SFRP3 (Secreted Frizzled Related Protein 3, sFRP-3, SRFP3, Frizzled-related Protein 1, FIZ, FRE, Frezzled, Fritz, FRP, FRZB, FRZB-PEN, Frzb1, FrzB-1, hFIZ, OS1) APC

Gene Names
FRZB; FRE; OS1; FZRB; hFIZ; FRITZ; FRP-3; FRZB1; SFRP3; SRFP3; FRZB-1; FRZB-PEN
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SFRP3; Polyclonal Antibody; SFRP3 (Secreted Frizzled Related Protein 3; sFRP-3; SRFP3; Frizzled-related Protein 1; FIZ; FRE; Frezzled; Fritz; FRP; FRZB; FRZB-PEN; Frzb1; FrzB-1; hFIZ; OS1) APC; anti-SFRP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FRZB. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SFRP3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FRZB, aa1-325 (NP_001454.2).
Immunogen Sequence
MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in mouse liver.)

Western Blot (WB) (FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in mouse liver.)

Western Blot (WB)

(FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in PC-12.)

Western Blot (WB) (FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in PC-12.)

Western Blot (WB)

(FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in Raw 264.7.)

Western Blot (WB) (FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in Raw 264.7.)

Western Blot (WB)

(FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in NIH/3T3.)

Western Blot (WB) (FRZB rabbit polyclonal antibody. Western Blot analysis of FRZB expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of FRZB expression in transfected 293T cell line by FRZB polyclonal antibody. Lane 1: FRZB transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FRZB expression in transfected 293T cell line by FRZB polyclonal antibody. Lane 1: FRZB transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SFRP3 antibody
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bone development.
Product Categories/Family for anti-SFRP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,254 Da
NCBI Official Full Name
secreted frizzled-related protein 3
NCBI Official Synonym Full Names
frizzled-related protein
NCBI Official Symbol
FRZB
NCBI Official Synonym Symbols
FRE; OS1; FZRB; hFIZ; FRITZ; FRP-3; FRZB1; SFRP3; SRFP3; FRZB-1; FRZB-PEN
NCBI Protein Information
secreted frizzled-related protein 3; frezzled; frizzled homolog-related; frizzled-related protein 1; sFRP-3
UniProt Protein Name
Secreted frizzled-related protein 3
UniProt Gene Name
FRZB
UniProt Synonym Gene Names
FIZ; FRE; FRP; FRZB1; SFRP3; sFRP-3
UniProt Entry Name
SFRP3_HUMAN

NCBI Description

The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility. [provided by RefSeq, Apr 2010]

Uniprot Description

FRZB: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bone development. Defects in FRZB are associated with susceptibility to osteoarthritis type 1(OS1). Osteoarthritis is a degenerative disease of the joints characterized by degradation of the hyaline articular cartilage and remodeling of the subchondral bone with sclerosis. Clinical symptoms include pain and joint stiffness often leading to significant disability and joint replacement. Belongs to the secreted frizzled-related protein (sFRP) family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2q32.1

Cellular Component: extracellular space; membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; Wnt receptor activity

Biological Process: negative regulation of cell proliferation; convergent extension involved in organogenesis; negative regulation of Wnt receptor signaling pathway; positive regulation of apoptosis; positive regulation of fat cell differentiation; neural crest cell differentiation; negative regulation of cell growth; skeletal development

Disease: Osteoarthritis Susceptibility 1

Research Articles on SFRP3

Similar Products

Product Notes

The SFRP3 frzb (Catalog #AAA6393905) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFRP3 (Secreted Frizzled Related Protein 3, sFRP-3, SRFP3, Frizzled-related Protein 1, FIZ, FRE, Frezzled, Fritz, FRP, FRZB, FRZB-PEN, Frzb1, FrzB-1, hFIZ, OS1) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SFRP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SFRP3 frzb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SFRP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.