Protein kinase APK1A, chloroplastic (APK1A) Recombinant Protein | APK1A recombinant protein
Recombinant Arabidopsis thaliana Protein kinase APK1A, chloroplastic (APK1A)
Gene Names
APK1A; APK1; F22G5.5; F22G5_5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein kinase APK1A; chloroplastic (APK1A); Recombinant Arabidopsis thaliana Protein kinase APK1A; APK1A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
39-410, Full length protein
Sequence
PSPRTEGEILQSPNLKSFSFAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGLYFQPLSWKLRLKVALGAAKGLAFLHSSETRVIYRDFKTSNILLDSEYNAKLSDFGLAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNMSEVVSHLEHIQSLNAAIGGNMDKTDRRMRRRSDSVVSKKVNAGFARQTAVGSTVVAYPRPSASPLYV
Sequence Length
372
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,519 Da
NCBI Official Full Name
Protein kinase superfamily protein
NCBI Official Symbol
APK1A
NCBI Official Synonym Symbols
APK1; F22G5.5; F22G5_5
NCBI Protein Information
Protein kinase superfamily protein
UniProt Protein Name
Probable serine/threonine-protein kinase PBL9
Protein Family
UniProt Gene Name
PBL9
NCBI Description
Protein kinase capable of phosphorylating tyrosine, serine, and threonine residues
Uniprot Description
Possible bi-functional kinase. In vitro, it exhibits serine/threonine activity. In vivo, can phosphorylate tyrosine residues of limited substrates (PubMed:1450380). May be involved in plant defense signaling ().
Similar Products
Product Notes
The APK1A pbl9 (Catalog #AAA1051533) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-410, Full length protein. The amino acid sequence is listed below: PSPRTEGEIL QSPNLKSFSF AELKSATRNF RPDSVLGEGG FGCVFKGWID EKSLTASRPG TGLVIAVKKL NQDGWQGHQE WLAEVNYLGQ FSHRHLVKLI GYCLEDEHRL LVYEFMPRGS LENHLFRRGL YFQPLSWKLR LKVALGAAKG LAFLHSSETR VIYRDFKTSN ILLDSEYNAK LSDFGLAKDG PIGDKSHVST RVMGTHGYAA PEYLATGHLT TKSDVYSFGV VLLELLSGRR AVDKNRPSGE RNLVEWAKPY LVNKRKIFRV IDNRLQDQYS MEEACKVATL SLRCLTTEIK LRPNMSEVVS HLEHIQSLNA AIGGNMDKTD RRMRRRSDSV VSKKVNAGFA RQTAVGSTVV AYPRPSASPL YV. It is sometimes possible for the material contained within the vial of "Protein kinase APK1A, chloroplastic (APK1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
