Lymphokine-activated killer T-cell-originated protein kinase (PBK) Recombinant Protein | PBK recombinant protein

Recombinant Human Lymphokine-activated killer T-cell-originated protein kinase (PBK)

Cat. Num. AAA1290021

• Gene Names: PBK; SPK; CT84; TOPK; HEL164; Nori-3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Lymphokine-activated killer T-cell-originated protein kinase (PBK); Recombinant Human Lymphokine-activated killer T-cell-originated protein kinase (PBK); Lymphokine-activated killer T-cell-originated protein kinase; EC=2.7.12.2; Cancer/testis antigen 84; CT84; MAPKK-like protein kinase; Nori-3; PDZ-binding kinase; Spermatogenesis-related protein kinase; SPK; T-LAK cell-originated protein kinase; PBK recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-322aa; Full Length
• Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
• Sequence Length: 322

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for PBK recombinant protein

Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.

Product Categories/Family for PBK recombinant protein

Cell Biology

NCBI and Uniprot Product Information

• NCBI GI #: 525507092
• NCBI GeneID: 55872
• NCBI Accession #: NP_001265874.1
• NCBI GenBank Nucleotide #: NM_001278945.1
• UniProt Accession #: Q96KB5; Q9NPD9; Q9NYL7; Q9NZK6; B4DX68; D3DST2
• Molecular Weight: 63.1 kDa
• NCBI Official Full Name: lymphokine-activated killer T-cell-originated protein kinase isoform 2
• NCBI Official Synonym Full Names: PDZ binding kinase
• NCBI Official Symbol: PBK
• NCBI Official Synonym Symbols: SPK; CT84; TOPK; HEL164; Nori-3
• NCBI Protein Information: lymphokine-activated killer T-cell-originated protein kinase; cancer/testis antigen 84; MAPKK-like protein kinase; epididymis luminal protein 164; serine/threonine protein kinase; T-LAK cell-originated protein kinase; spermatogenesis-related protein kinase
• UniProt Protein Name: Lymphokine-activated killer T-cell-originated protein kinase
• Protein Family: Lymphokine-activated killer T-cell-originated protein kinase
• UniProt Gene Name: PBK
• UniProt Synonym Gene Names: TOPK; CT84; SPK
• UniProt Entry Name: TOPK_HUMAN

NCBI Description

This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

PBK: Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage. Interacts with DLG1 and TP53. Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules. Activated by phosphorylation. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase kinase subfamily.

Protein type: Cancer Testis Antigen (CTA); EC 2.7.12.2; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, Other; Other group; TOPK family

Chromosomal Location of Human Ortholog: 8p21.2

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: mitosis; negative regulation of protein amino acid phosphorylation; negative regulation of inflammatory response; negative regulation of stress-activated MAPK cascade; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; protein amino acid phosphorylation