DNA polymerase sigma (Papd7) Recombinant Protein | Papd7 recombinant protein
Recombinant Mouse DNA polymerase sigma (Papd7)
Gene Names
Papd7; POLK; Pols; TRF4; LAK-1; TRF4-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA polymerase sigma (Papd7); Recombinant Mouse DNA polymerase sigma (Papd7); Papd7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-542, Full length protein
Sequence
MSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGGISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCIEDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTLGRIIKVTQEVIDYRRWIKEKWGSRILPSPDLDNRIKIKERITTCNGEQMQSREPSSPYTQRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAPTTLMASLPTALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVTSPAIPSASPNPLSSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHHQYNRTGWRRKKHAHTRDSLPVSLSR
Sequence Length
542
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,027 Da
NCBI Official Full Name
non-canonical poly(A) RNA polymerase PAPD7 isoform 1
NCBI Official Synonym Full Names
PAP associated domain containing 7
NCBI Official Symbol
Papd7
NCBI Official Synonym Symbols
POLK; Pols; TRF4; LAK-1; TRF4-1
NCBI Protein Information
non-canonical poly(A) RNA polymerase PAPD7
UniProt Protein Name
Non-canonical poly(A) RNA polymerase PAPD7
UniProt Gene Name
Papd7
UniProt Synonym Gene Names
Pols
Uniprot Description
Catalytic subunit of a TRAMP-like complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism. Polyadenylation with short oligo(A) tails is required for the degradative activity of the exosome on several of its nuclear RNA substrates. Has no terminal uridylyltransferase activity, and does not play a role in replication-dependent histone mRNA degradation via uridylation ().
Similar Products
Product Notes
The Papd7 papd7 (Catalog #AAA1451896) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-542, Full length protein. The amino acid sequence is listed below: MSPCPEEAAM RREVVKRIET VVKDLWPTAD VQIFGSFSTG LYLPTSDIDL VVFGKWERPP LQLLEQALRK HNVAEPCSIK VLDKATVPII KLTDQETEVK VDISFNMETG VRAAEFIKNY MKKYSLLPYL ILVLKQFLLQ RDLNEVFTGG ISSYSLILMA ISFLQLHPRI DARRADENLG MLLVEFFELY GRNFNYLKTG IRIKEGGAYI AKEEIMKAMT SGYRPSMLCI EDPLLPGNDV GRSSYGAMQV KQVFDYAYIV LSHAVSPLAR SYPNRDSEST LGRIIKVTQE VIDYRRWIKE KWGSRILPSP DLDNRIKIKE RITTCNGEQM QSREPSSPYT QRLTLSLSSP QLLSSGSSAS SVSSLSGSDI DSDTPPCTTP SVYQFSLQAP TTLMASLPTA LPMPSSKPQP AASRTLIMTT NNQTRVTIPP PTLGVAPVPC RQAGVDGTTS LKAVHSVTSP AIPSASPNPL SSPHLYHKQH NGMKLSMKGS HNHTQGGGYS SVGSGAVRPP VGNRGHHQYN RTGWRRKKHA HTRDSLPVSL SR. It is sometimes possible for the material contained within the vial of "DNA polymerase sigma (Papd7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
