NADP-dependent alkenal double bond reductase P2 (P2) Recombinant Protein | P2 recombinant protein
Recombinant Arabidopsis thaliana NADP-dependent alkenal double bond reductase P2 (P2)
Gene Names
AT5G16990; F2K13.140; F2K13_140
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NADP-dependent alkenal double bond reductase P2 (P2); Recombinant Arabidopsis thaliana NADP-dependent alkenal double bond reductase P2 (P2); P2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-343, Full length protein
Sequence
MTTNKQVIFKDHVSGFPKESDFNFTTTTVELRVPEGSKSVLVKNLYLSCDPYMRSRMGKPDPSSALAQAYAPGKPIYGYGVSRVIESGHPDYKKGDLLWGIVGWEEYSVITPMAHMHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKKGETVYVSAASGAVGQLVGQFAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLSAALKRCFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNIIYKRIRIQGFVVADFYDKYPKFLELVLPRIKEGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVIARE
Sequence Length
343
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,989 Da
NCBI Official Full Name
Zinc-binding dehydrogenase family protein
NCBI Official Symbol
AT5G16990
NCBI Official Synonym Symbols
F2K13.140; F2K13_140
NCBI Protein Information
Zinc-binding dehydrogenase family protein
UniProt Protein Name
NADP-dependent alkenal double bond reductase P2
Protein Family
UniProt Gene Name
P2
NCBI Description
molecular function has not been defined, was shown involved in oxidative stress tolerance.
Uniprot Description
Catalyzes the reduction of the 7-8 double bond of phenylpropanal substrates, such as p-coumaryl aldehyde and coniferyl aldehyde (in vitro). Has activity towards toxic substrates, such as 4-hydroxy-(2E)-nonenal (in vitro) (). May play a distinct role in plant antioxidant defense and is possibly involved in NAD(P)/NAD(P)h homeostasis.
Similar Products
Product Notes
The P2 p2 (Catalog #AAA1320167) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-343, Full length protein. The amino acid sequence is listed below: MTTNKQVIFK DHVSGFPKES DFNFTTTTVE LRVPEGSKSV LVKNLYLSCD PYMRSRMGKP DPSSALAQAY APGKPIYGYG VSRVIESGHP DYKKGDLLWG IVGWEEYSVI TPMAHMHFKI QHTDVPLSYY TGLLGMPGMT AYAGFYEVCS PKKGETVYVS AASGAVGQLV GQFAKMMGCY VVGSAGSKEK VDLLKTKFGF DDAFNYKEES DLSAALKRCF PKGIDMYFEN VGGKMLDAVL LNMNPHGRIA VCGMISQYNL ENQEGVHNLS NIIYKRIRIQ GFVVADFYDK YPKFLELVLP RIKEGKITYV EDVADGLEKA PEALVGLFHG KNVGKQVVVI ARE. It is sometimes possible for the material contained within the vial of "NADP-dependent alkenal double bond reductase P2 (P2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
