Sativa Subsp. Japonica TPR Repeat-Containing Thioredoxin TDX Recombinant Protein | LOC4346999 recombinant protein

Recombinant Oryza Sativa Subsp. Japonica TPR Repeat-Containing Thioredoxin TDX (Os09g0401200)

Cat. Num. AAA7115319

• Gene Names: LOC4346999; OsTDX; OsTrx26
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sativa Subsp. Japonica TPR Repeat-Containing Thioredoxin TDX; Recombinant Oryza Sativa Subsp. Japonica TPR Repeat-Containing Thioredoxin TDX (Os09g0401200); OsTrx26; Tetratricoredoxin; OsTDX; LOC4346999 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-317aa; Full Length
• Sequence: MATAGASSFEDEIMESDIELEGEAVEPDNDPPQKMGDPSVEVSDEKRDQAQLCKNKGVDAFSEGKLDEAIEHLTEAIVLNPTSAIAYATRAVIFVKSKKPNAAIRDADAALKINPDSAKGYKSRGMAKAMLGKWEEAAQDLRMAAKLDYDEEIGAELKKVEPNVLKIEEHRKKYERLRKERDIKKAEMEKQRKHAEEVSAASAALKDGDVIAIHSSSELDTKLKAASSLSRLVVLYFTAAWCGPCRFIGPVCKSLAEKHRNVVFLKVDIDELNSVAYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQHGSS
• Sequence Length: 317

• Species: Rice
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Protein Families: Thioredoxin family
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-81 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 5 degree C for up to one week.

Related Product Information for LOC4346999 recombinant protein

Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats (By similarity).

References

"Comparative genomic study of the thioredoxin family in photosynthetic organisms with emphasis on Populus trichocarpa." Chibani K., Wingsle G., Jacquot J.P., Gelhaye E., Rouhier N. Mol. Plant 2:308-322(2009).

NCBI and Uniprot Product Information

• NCBI GI #: 1002298401
• NCBI GeneID: 4346999
• NCBI Accession #: XP_015612619.1
• NCBI GenBank Nucleotide #: XM_015757133.2
• UniProt Accession #: Q6ES52
• Molecular Weight: 42.0 kDa
• NCBI Official Full Name: TPR repeat-containing thioredoxin TDX
• NCBI Official Symbol: LOC4346999
• NCBI Official Synonym Symbols: OsTDX; OsTrx26
• NCBI Protein Information: TPR repeat-containing thioredoxin TDX
• UniProt Protein Name: TPR repeat-containing thioredoxin TDX
• UniProt Gene Name: Os09g0401200
• UniProt Synonym Gene Names: OsTDX

Uniprot Description

Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats ().