Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940) Recombinant Protein | Os05g0151300 recombinant protein

Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)

Gene Names
LOC4337833; OsJ_016392
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300; LOC_Os05g05940); Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300; Os05g0151300 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-253, Full length protein
Sequence
MADSGSDAPISNRPEEEVTVEKTPEMEAAAEEERLRYLEFVQQAAAQVLVLAAAAYAYAKQGAGPLRPGVDHVEGTVKAVVGPVYDRFHGVPLDLLKFLDRKVGESVQELDRRVPPVVKEAPGLARSAAAEVRQAGLVGTATGLAKSAIARAEPRARDLYTRYEPVAERKAAEAWAALNRLPLVPSVTRAVLPAAASLSARYNTAVADGAKRGSAVATYLPLVPTERLSRVFGYPLADAATSPAPEMQPIPSQ
Sequence Length
253
Species
Oryza sativa subsp. japonica (Rice)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,860 Da
NCBI Official Full Name
REF/SRPP-like protein Os05g0151300/LOC_Os05g05940
NCBI Official Symbol
LOC4337833
NCBI Official Synonym Symbols
OsJ_016392
NCBI Protein Information
REF/SRPP-like protein Os05g0151300/LOC_Os05g05940
UniProt Protein Name
REF/SRPP-like protein Os05g0151300/LOC_Os05g05940
Protein Family
UniProt Gene Name
Os05g0151300

Similar Products

Product Notes

The Os05g0151300 os05g0151300 (Catalog #AAA1454264) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-253, Full length protein. The amino acid sequence is listed below: MADSGSDAPI SNRPEEEVTV EKTPEMEAAA EEERLRYLEF VQQAAAQVLV LAAAAYAYAK QGAGPLRPGV DHVEGTVKAV VGPVYDRFHG VPLDLLKFLD RKVGESVQEL DRRVPPVVKE APGLARSAAA EVRQAGLVGT ATGLAKSAIA RAEPRARDLY TRYEPVAERK AAEAWAALNR LPLVPSVTRA VLPAAASLSA RYNTAVADGA KRGSAVATYL PLVPTERLSR VFGYPLADAA TSPAPEMQPI PSQ. It is sometimes possible for the material contained within the vial of "REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.