Outer envelope pore protein 16-3, chloroplastic/mitochondrial (OEP163) Recombinant Protein | OEP16-3 recombinant protein
Recombinant Arabidopsis thaliana Outer envelope pore protein 16-3, chloroplastic/mitochondrial (OEP163)
Gene Names
OEP16-3; ATOEP16-3; OEP16-3; T24P15.12; T24P15_12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer envelope pore protein 16-3; chloroplastic/mitochondrial (OEP163); Recombinant Arabidopsis thaliana Outer envelope pore protein 16-3; Recombinant Outer envelope pore protein 16-3; chloroplastic/mitochondrial; Chloroplastic outer envelope pore protein of 16 kDa 3; AtOEP16-3; OEP16-3; OEP16-3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-159
Sequence
MDPAEMRYLEEEDGPLMKTIKGSITGFGAGTIYGTILATWKDVPRVERNVALPGLIRTLKMMGTHGLTFAAIGGVYIGVEQLVQNFRSKRDFYNGAIGGFVAGASVLGYRARSIPTAIAAGATLAVTSALIDSGGQTTRVDNGREYYPYTVEKRAEADS
Sequence Length
159
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,999 Da
NCBI Official Full Name
Tim17 domain-containing protein
NCBI Official Symbol
OEP16-3
NCBI Official Synonym Symbols
ATOEP16-3; OEP16-3; T24P15.12; T24P15_12
NCBI Protein Information
Tim17 domain-containing protein
UniProt Protein Name
Outer envelope pore protein 16-3, chloroplastic/mitochondrial
UniProt Gene Name
OEP163
UniProt Synonym Gene Names
AtOEP16-3; OEP16-3
UniProt Entry Name
OP163_ARATH
NCBI Description
Homologous to pea OEP16 and barley pPORA (OEP16), a member of Arabidopsis OEP16 family.
Uniprot Description
Function: Voltage-dependent high-conductance channel with a slightly cation-selectivity; selective for amino acids but excludes triosephosphates or uncharged sugars
By similarity.
Subunit structure: Homodimer and oligomers in membrane
By similarity.
Subcellular location: Plastid › chloroplast outer membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein Ref.1 Ref.8 Ref.9 Ref.10.
Sequence similarities: Belongs to the Tim17/Tim22/Tim23 family. Plastid outer envelope porin OEP16 (TC 1.B.30) subfamily. [View classification]
Research Articles on OEP16-3
Similar Products
Product Notes
The OEP16-3 oep163 (Catalog #AAA1140410) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-159. The amino acid sequence is listed below: MDPAEMRYLE EEDGPLMKTI KGSITGFGAG TIYGTILATW KDVPRVERNV ALPGLIRTLK MMGTHGLTFA AIGGVYIGVE QLVQNFRSKR DFYNGAIGGF VAGASVLGYR ARSIPTAIAA GATLAVTSAL IDSGGQTTRV DNGREYYPYT VEKRAEADS. It is sometimes possible for the material contained within the vial of "Outer envelope pore protein 16-3, chloroplastic/mitochondrial (OEP163), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
