GTPase ObgE/CgtA (obgE) Recombinant Protein | obgE recombinant protein

Recombinant Escherichia coli GTPase ObgE/CgtA (obgE)

Cat. Num. AAA1218682

• Gene Names: obgE; cgtA; ECK3172; JW3150; obg; yhbZ
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: GTPase ObgE/CgtA (obgE); Recombinant Escherichia coli GTPase ObgE/CgtA (obgE); obgE recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-390, full length protein
• Sequence: MKFVDEASILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDVWMEADENLNTLIDYRFEKSFRAERGQNGASRDCTGKRGKDVTIKVPVGTRVIDQGTGETMGDMTKHGQRLLVAKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRELLLELMLLADVGMLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDNEKSFVVADIPGLIEGAAEGAGLGIRFLKHLERCRVLLHLIDIDPIDGTDPVENARIIISELEKYSQDLATKPRWLVFNKIDLLDKVEAEEKAKAIAEALGWEDKYYLISAASGLGVKDLCWDVMTFIIENPVVQAEEAKQPEKVEFMWDDYHRQQLEEIAEEDDEDWDDDWDEDDEEGVEFIYKR
• Sequence Length: 390

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16131073
• NCBI GeneID: 947694
• NCBI Accession #: NP_417650.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P42641; Q2M929
• Molecular Weight: 43,286 Da
• NCBI Official Full Name: GTPase involved in cell partioning and DNA repair
• NCBI Official Symbol: obgE
• NCBI Official Synonym Symbols: cgtA; ECK3172; JW3150; obg; yhbZ
• NCBI Protein Information: GTPase involved in cell partioning and DNA repair
• UniProt Protein Name: GTPase ObgE/CgtA
• Protein Family: GTPase
• UniProt Gene Name: obgE

NCBI Description

obgE mutants have lowered DnaA and elevated basal level ppGpp. obgE is required for phage lambda development. [More information is available at EcoGene: EG12795]. ObgE is an essential member of the Obg family of small GTP-binding proteins . [More information is available at EcoCyc: G7656].

Uniprot Description

An abundant, essential GTPase which binds GTP, GDP and ppGpp with moderate affinity. Has high guanosine nucleotide exchange rate constants for GTP and GDP, and a relatively low GTP hydrolysis rate stimulated by the 50S ribosomal subunit. It is estimated there are 34000 molecules in log-phase cells and 5600 molecules in stationary-phase cells. Required for chromosome segregation. Plays a role in the stringent response, perhaps by sequestering 50S ribosomal subunits and decreasing protein synthesis (PubMed:19555460), and a non-essential role in the late steps of ribosome biogenesis, perhaps acting as a checkpoint for correct 50S subunit synthesis (Probable) (PubMed:24844575). Overexpression increases bacterial persistence (in exponential and stationary phase) in response to antibiotics (PubMed:26051177). Cells expressing high levels of Obg are more likely to form persister cells upon antibiotic exposure; this requires alarmone (p)ppGpp and acts via induced HokB, depolarizing cells, which probably reduces metabolic activity and induces persistence (PubMed:26051177). The persister phenotype can be separated from the essential phenotype (PubMed:26051177).