Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GTPase ObgE/CgtA (obgE) Recombinant Protein | obgE recombinant protein

Recombinant Escherichia coli GTPase ObgE/CgtA (obgE)

Gene Names
obgE; cgtA; ECK3172; JW3150; obg; yhbZ
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GTPase ObgE/CgtA (obgE); Recombinant Escherichia coli GTPase ObgE/CgtA (obgE); obgE recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-390, full length protein
Sequence
MKFVDEASILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDVWMEADENLNTLIDYRFEKSFRAERGQNGASRDCTGKRGKDVTIKVPVGTRVIDQGTGETMGDMTKHGQRLLVAKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRELLLELMLLADVGMLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDNEKSFVVADIPGLIEGAAEGAGLGIRFLKHLERCRVLLHLIDIDPIDGTDPVENARIIISELEKYSQDLATKPRWLVFNKIDLLDKVEAEEKAKAIAEALGWEDKYYLISAASGLGVKDLCWDVMTFIIENPVVQAEEAKQPEKVEFMWDDYHRQQLEEIAEEDDEDWDDDWDEDDEEGVEFIYKR
Sequence Length
390
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,286 Da
NCBI Official Full Name
GTPase involved in cell partioning and DNA repair
NCBI Official Symbol
obgE
NCBI Official Synonym Symbols
cgtA; ECK3172; JW3150; obg; yhbZ
NCBI Protein Information
GTPase involved in cell partioning and DNA repair
UniProt Protein Name
GTPase ObgE/CgtA
Protein Family
UniProt Gene Name
obgE

NCBI Description

obgE mutants have lowered DnaA and elevated basal level ppGpp. obgE is required for phage lambda development. [More information is available at EcoGene: EG12795]. ObgE is an essential member of the Obg family of small GTP-binding proteins . [More information is available at EcoCyc: G7656].

Uniprot Description

An abundant, essential GTPase which binds GTP, GDP and ppGpp with moderate affinity. Has high guanosine nucleotide exchange rate constants for GTP and GDP, and a relatively low GTP hydrolysis rate stimulated by the 50S ribosomal subunit. It is estimated there are 34000 molecules in log-phase cells and 5600 molecules in stationary-phase cells. Required for chromosome segregation. Plays a role in the stringent response, perhaps by sequestering 50S ribosomal subunits and decreasing protein synthesis (PubMed:19555460), and a non-essential role in the late steps of ribosome biogenesis, perhaps acting as a checkpoint for correct 50S subunit synthesis (Probable) (PubMed:24844575). Overexpression increases bacterial persistence (in exponential and stationary phase) in response to antibiotics (PubMed:26051177). Cells expressing high levels of Obg are more likely to form persister cells upon antibiotic exposure; this requires alarmone (p)ppGpp and acts via induced HokB, depolarizing cells, which probably reduces metabolic activity and induces persistence (PubMed:26051177). The persister phenotype can be separated from the essential phenotype (PubMed:26051177).

Research Articles on obgE

Similar Products

Product Notes

The obgE obge (Catalog #AAA1218682) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-390, full length protein. The amino acid sequence is listed below: MKFVDEASIL VVAGDGGNGC VSFRREKYIP KGGPDGGDGG DGGDVWMEAD ENLNTLIDYR FEKSFRAERG QNGASRDCTG KRGKDVTIKV PVGTRVIDQG TGETMGDMTK HGQRLLVAKG GWHGLGNTRF KSSVNRTPRQ KTNGTPGDKR ELLLELMLLA DVGMLGMPNA GKSTFIRAVS AAKPKVADYP FTTLVPSLGV VRMDNEKSFV VADIPGLIEG AAEGAGLGIR FLKHLERCRV LLHLIDIDPI DGTDPVENAR IIISELEKYS QDLATKPRWL VFNKIDLLDK VEAEEKAKAI AEALGWEDKY YLISAASGLG VKDLCWDVMT FIIENPVVQA EEAKQPEKVE FMWDDYHRQQ LEEIAEEDDE DWDDDWDEDD EEGVEFIYKR. It is sometimes possible for the material contained within the vial of "GTPase ObgE/CgtA (obgE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.