Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Natriuretic peptides A (NPPA) Recombinant Protein | NPPA recombinant protein

Recombinant Human Natriuretic peptides A (NPPA)

Gene Names
NPPA; ANF; ANP; PND; ATFB6; CDD-ANF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Natriuretic peptides A (NPPA); Recombinant Human Natriuretic peptides A (NPPA); CDD-ANF (Cardiodilatin)(CDD)(Cardiodilatin-related peptide)(CDP); NPPA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
78-115AA, Partial
Sequence
PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL
Species
Homo sapiens (Human)
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for NPPA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
16,708 Da
NCBI Official Full Name
atrial natriuretic peptide
NCBI Official Synonym Full Names
natriuretic peptide A
NCBI Official Symbol
NPPA
NCBI Official Synonym Symbols
ANF; ANP; PND; ATFB6; CDD-ANF
NCBI Protein Information
natriuretic peptides A; atriopeptin; cardionatrin; prepronatriodilatin; natriuretic peptide precursor A
UniProt Protein Name
Natriuretic peptides A
UniProt Gene Name
NPPA
UniProt Synonym Gene Names
ANP; PND; CDP; ANF; ANP
UniProt Entry Name
ANF_HUMAN

NCBI Description

The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. [provided by RefSeq, Sep 2009]

Uniprot Description

NPPA: Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Defects in NPPA are the cause of familial atrial fibrillation type 6 (ATFB6). Atrial fibrillation is a common disorder of cardiac rhythm that is hereditary in a small subgroup of patients. It is characterized by disorganized atrial electrical activity, progressive deterioration of atrial electromechanical function and ineffective pumping of blood into the ventricles. It can be associated with palpitations, syncope, thromboembolic stroke, and congestive heart failure. Belongs to the natriuretic peptide family.

Protein type: Secreted, signal peptide; Hormone; Secreted

Chromosomal Location of Human Ortholog: 1p36.21

Cellular Component: extracellular space; mast cell granule; perinuclear region of cytoplasm; extracellular region; nucleus

Molecular Function: neuropeptide hormone activity; peptide hormone receptor binding; receptor binding

Biological Process: cardiac muscle hypertrophy; transcription initiation from RNA polymerase II promoter; cGMP biosynthetic process; negative regulation of systemic arterial blood pressure; positive regulation of heart rate; female pregnancy; response to insulin stimulus; neuropeptide signaling pathway; regulation of blood pressure; receptor guanylyl cyclase signaling pathway; response to hypoxia; gene expression; negative regulation of cell growth; regulation of blood vessel size

Disease: Atrial Standstill 2; Atrial Fibrillation, Familial, 6

Research Articles on NPPA

Similar Products

Product Notes

The NPPA nppa (Catalog #AAA9018652) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 78-115AA, Partial. The amino acid sequence is listed below: PEVPPWTGEV SPAQRDGGAL GRGPWDSSDR SALLKSKL. It is sometimes possible for the material contained within the vial of "Natriuretic peptides A (NPPA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.