Nanos homolog 3 Recombinant Protein | Nos3 recombinant protein

Recombinant Rat Nanos homolog 3 protein

Cat. Num. AAA1265277

• Gene Names: Nos3; eNos
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Nanos homolog 3; Recombinant Rat Nanos homolog 3 protein; Constitutive NOS; cNO; SEC-NOS; Endothelial NOS; eNOS; NOS type III; NOSIII; Nos3 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 519-690aa; Partial
• Sequence: ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ
• Sequence Length: 1202

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Nos3 recombinant protein

Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.

References

NIDD, a novel DHHC-containing protein, targets neuronal nitric-oxide synthase (nNOS) to the synaptic membrane through a PDZ-dependent interaction and regulates nNOS activity.Saitoh F., Tian Q.B., Okano A., Sakagami H., Kondo H., Suzuki T.J. Biol. Chem. 279:29461-29468(2004) Downregulation of endothelial nitric oxide synthase (NOS III) in rat aorta following in-vivo hypoxia.Toporsian M., Govindaraju K., Nagi M., Eidelman D., Thibault G., Ward M.E. Increased resistance to myocardial ischemia in the Brown Norway vs. Dahl S rat role of nitric oxide synthase and Hsp90.Shi Y., Hutchins W., Ogawa H., Chang C.-C., Pritchard K.A. Jr., Zhang C., Khampang P., Lazar J., Jacob H.J., Rafiee P., Baker J.E.J. Mol. Cell. Cardiol. 38:625-635(2005) Cloning and expression of the rat endothelial nitric oxide synthase.Seidel B., Jiang L., Wolf G. Differential expression and induction of mRNAs encoding two inducible nitric oxide synthases in rat kidney.Mohaupt M.G., Elzie J.L., Ahn K.Y., Clapp W.L., Wilcox C.S., Kone B.C.Kidney Int. 46:653-665(1994) Endothelin-1, endothelin receptors and ecNOS mRNA expression in vital organs during traumatic shock in rats.Minchenko A.G., Armstead V.E., Opentanova I.L., Lefer A.M. Constitutive endothelial nitric oxide synthase gene expression is regulated during lung development.Kawai N., Bloch D.B., Filippov G., Rabkina D., Suen H.C., Losty P.D., Janssens S.P., Zapol W.M., de la Monte S., Bloch K.D.Am. J. Physiol. 268:L589-L595(1995) AMP-activated protein kinase phosphorylation of endothelial NO synthase.Chen Z.P., Mitchelhill K.I., Michell B.J., Stapleton D., Rodriguez-Crespo I., Witters L.A., Power D.A., Ortiz de Montellano P.R., Kemp B.E.FEBS Lett. 443:285-289(1999)

NCBI and Uniprot Product Information

• NCBI GI #: 46402488
• NCBI GeneID: 24600
• NCBI Accession #: NP_068610.1
• NCBI GenBank Nucleotide #: NM_021838.2
• UniProt Accession #: Q62600; O88672; O89041; Q62734; Q68GV6; Q75NE4
• Molecular Weight: 22.9 kDa
• NCBI Official Full Name: nitric oxide synthase, endothelial
• NCBI Official Synonym Full Names: nitric oxide synthase 3
• NCBI Official Symbol: Nos3
• NCBI Official Synonym Symbols: eNos
• NCBI Protein Information: nitric oxide synthase, endothelial
• UniProt Protein Name: Nitric oxide synthase, endothelial
• Protein Family: Nanos
• UniProt Gene Name: Nos3
• UniProt Synonym Gene Names: cNOS; eNOS; NOSIII
• UniProt Entry Name: NOS3_RAT

NCBI Description

enzyme that synthesizes Nitric oxide from L-arginine [RGD, Feb 2006]

Uniprot Description

eNOS: endothelial constitutive nitric oxide synthase. Synthesizes nitric oxide (NO) from arginine and oxygen, which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets. Induced in humans by caloric restriction. Stimulated by calcium/calmodulin. Inhibited by NOSIP and NOSTRIN.

Protein type: EC 1.14.13.39; Amino Acid Metabolism - arginine and proline; Oxidoreductase

Cellular Component: apical part of cell; caveola; cytoplasm; cytoskeleton; cytosol; Golgi apparatus; lipid raft; mitochondrion; nucleolus; nucleus; plasma membrane; sarcolemma; vesicle membrane

Molecular Function: actin binding; actin monomer binding; beta-catenin binding; cadherin binding; calmodulin binding; FAD binding; FMN binding; heme binding; Hsp90 protein binding; iron ion binding; NADP binding; nitric-oxide synthase activity; nitric-oxide synthase binding; protein binding

Biological Process: aging; angiogenesis; arginine catabolic process; blood vessel remodeling; endothelial cell migration; female pregnancy; in utero embryonic development; lipopolysaccharide-mediated signaling pathway; lung development; negative regulation of blood pressure; negative regulation of calcium ion transport; negative regulation of cell proliferation; negative regulation of hydrolase activity; negative regulation of muscle hyperplasia; negative regulation of potassium ion transport; negative regulation of smooth muscle cell proliferation; nitric oxide biosynthetic process; nitric oxide mediated signal transduction; ovulation from ovarian follicle; positive regulation of angiogenesis; positive regulation of apoptosis; positive regulation of guanylate cyclase activity; positive regulation of vasodilation; regulation of blood vessel size; regulation of sodium ion transport; regulation of systemic arterial blood pressure by endothelin; regulation of the force of heart contraction by chemical signal; removal of superoxide radicals; response to activity; response to amino acid stimulus; response to axon injury; response to corticosterone stimulus; response to cytokine stimulus; response to drug; response to estradiol stimulus; response to ethanol; response to fructose stimulus; response to hyperoxia; response to hypoxia; response to lead ion; response to lipopolysaccharide; response to lipoprotein stimulus; response to mechanical stimulus; response to metal ion; response to organic cyclic substance; response to peptide hormone stimulus; retina development in camera-type eye; signal transduction; smooth muscle hyperplasia