Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nuclear hormone receptor family member nhr-268 (nhr-268) Recombinant Protein | nhr-268 recombinant protein

Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-268 (nhr-268)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nuclear hormone receptor family member nhr-268 (nhr-268); Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-268 (nhr-268); nhr-268 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-340, Full length
Sequence
MNCLVCSARAFNRNYGVMSCFACKMFFRRTVFKNMLFNCKYFKNCTIHYKTHPKCRACRFQKCLNIGMKAASKNDRIVSIGNYEDYNFDKLLNDLIVKNDKNYSNFIDFYSLEDPSLKDIIEDRSIMKLVRRTPETLNDVDQWSNMLAYSRISYFLDFNFIRELDSSDKNTLFKYNVSRAGCLALAMCAYSENKPKLTFPNDVDIFPSEMYNLCGSSTAVLNQVSGQVIAKFIELEIRQEEYLLLLLVMFCNASITNNFSHKTKLILSSHQQVYCSALFRYCQLKYSKSAPTRFTELLSVFGIVNKSVNNMSFLSMMVQCYNPKFNFKRLMQDIFSHTLS
Sequence Length
340
Species
Caenorhabditis elegans
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,633 Da
NCBI Official Full Name
Nuclear hormone receptor family member nhr-268
NCBI Official Symbol
nhr-268
NCBI Protein Information
Nuclear hormone receptor family member nhr-268
UniProt Protein Name
Nuclear hormone receptor family member nhr-268
UniProt Gene Name
nhr-268

Uniprot Description

Orphan nuclear receptor.

Similar Products

Product Notes

The nhr-268 nhr-268 (Catalog #AAA1027114) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-340, Full length. The amino acid sequence is listed below: MNCLVCSARA FNRNYGVMSC FACKMFFRRT VFKNMLFNCK YFKNCTIHYK THPKCRACRF QKCLNIGMKA ASKNDRIVSI GNYEDYNFDK LLNDLIVKND KNYSNFIDFY SLEDPSLKDI IEDRSIMKLV RRTPETLNDV DQWSNMLAYS RISYFLDFNF IRELDSSDKN TLFKYNVSRA GCLALAMCAY SENKPKLTFP NDVDIFPSEM YNLCGSSTAV LNQVSGQVIA KFIELEIRQE EYLLLLLVMF CNASITNNFS HKTKLILSSH QQVYCSALFR YCQLKYSKSA PTRFTELLSV FGIVNKSVNN MSFLSMMVQC YNPKFNFKRL MQDIFSHTLS. It is sometimes possible for the material contained within the vial of "Nuclear hormone receptor family member nhr-268 (nhr-268), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.