Neuroglobin Recombinant Protein | NGB recombinant protein

Recombinant Human Neuroglobin

Cat. Num. AAA1382805

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Neuroglobin; Recombinant Human Neuroglobin; NGB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-151aa; Full Length
• Sequence: MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
• Sequence Length: 151

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for NGB recombinant protein

Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell membranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis.

Product Categories/Family for NGB recombinant protein

Transport

References

A vertebrate globin expressed in the brain.Burmester T., Weich B., Reinhardt S., Hankeln T.Nature 407:520-522(2000) Full-length cDNA cloning of human neuroglobin and tissue expression of rat neuroglobin.Zhang C.G., Wang C.L., Deng M.Y., Li L., Wang H.Y., Fan M., Xu W.L., Meng F.W., Qian L., He F.C.Biochem. Biophys. Res. Commun. 290:1411-1419(2002) The DNA sequence and analysis of human chromosome 14.Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.Nature 421:601-607(2003) Biochemical characterization and ligand binding properties of neuroglobin, a novel member of the globin family.Dewilde S., Kiger L., Burmester T., Hankeln T., Baudin-Creuza V., Aerts T., Marden M.C., Caubergs R., Moens L.J. Biol. Chem. 276:38949-38955(2001) Coupling of the heme and an internal disulfide bond in human neuroglobin.Hamdane D., Kiger L., Dewilde S., Green B.N., Pesce A., Uzan J., Burmester T., Hankeln T., Bolognesi M., Moens L., Marden M.C.Micron 35:59-62(2004) Zebrafish neuroglobin is a cell-membrane-penetrating globin.Watanabe S., Wakasugi K.Biochemistry 47:5266-5270(2008) A role for human neuroglobin in apoptosis.Brittain T., Skommer J., Henty K., Birch N., Raychaudhuri S.IUBMB Life 62:878-885(2010) Human neuroglobin functions as a redox-regulated nitrite reductase.Tiso M., Tejero J., Basu S., Azarov I., Wang X., Simplaceanu V., Frizzell S., Jayaraman T., Geary L., Shapiro C., Ho C., Shiva S., Kim-Shapiro D.B., Gladwin M.T.J. Biol. Chem. 286:18277-18289(2011) 14-3-3 binding and phosphorylation of neuroglobin during hypoxia modulate six-to-five heme pocket coordination and rate of nitrite reduction to nitric oxide.Jayaraman T., Tejero J., Chen B.B., Blood A.B., Frizzell S., Shapiro C., Tiso M., Hood B.L., Wang X., Zhao X., Conrads T.P., Mallampalli R.K., Gladwin M.T.J. Biol. Chem. 286:42679-42689(2011) Human brain neuroglobin structure reveals a distinct mode of controlling oxygen affinity.Pesce A., Dewilde S., Nardini M., Moens L., Ascenzi P., Hankeln T., Burmester T., Bolognesi M.Structure 11:1087-1095(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 10864065
• NCBI GeneID: 58157
• NCBI Accession #: NP_067080.1
• NCBI GenBank Nucleotide #: NM_021257.3
• UniProt Accession #: Q9NPG2
• Molecular Weight: 32.9 kDa
• NCBI Official Full Name: neuroglobin
• NCBI Official Synonym Full Names: neuroglobin
• NCBI Official Symbol: NGB
• NCBI Protein Information: neuroglobin
• UniProt Protein Name: Neuroglobin
• Protein Family: Neuroglobin
• UniProt Gene Name: NGB
• UniProt Entry Name: NGB_HUMAN

NCBI Description

This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions. [provided by RefSeq, Jul 2008]

Uniprot Description

NGB: Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell membranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis. Belongs to the globin family.

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: mitochondrion; perikaryon

Molecular Function: heme binding; metal ion binding; oxygen binding; oxygen transporter activity; protein binding

Biological Process: apoptosis; oxygen transport