Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human NEDD8 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 9 kDa.)

NEDD8 recombinant protein

Recombinant Human NEDD8 Protein

Gene Names
NEDD8; NEDD-8
Purity
>97% by SDS-PAGE.
Synonyms
NEDD8; Recombinant Human NEDD8 Protein; NEDD-8; NEDD8 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Sequence Length
81
Species
Human
Endotoxin
Please contact us for more information.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human NEDD8 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 9 kDa.)

SDS-Page (Recombinant Human NEDD8 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 9 kDa.)
Related Product Information for NEDD8 recombinant protein
Description: Recombinant Human NEDD8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly76) of human NEDD8 (Accession #NP_006147.1) fused with a 6xHis tag at the C-terminus.

Background: Neural Precursor Cell Expressed Developmentally Downregulated Gene 8 (NEDD8), also known as Related to Ubiquitin 1 (Rub1), is a 6-8 kDa member of the Ubiquitin family of proteins. Human NEDD8 is activated by a distinct NEDD8-activating (E1) enzyme, a heterodimeric complex composed of APPBP1 and UBA3 subunits. Activated NEDD8 is subsequently transferred to the UBE2M/Ubc12 or UBE2F NEDD8-conjugating (E2) enzymes. Through a process termed neddylation, the ROC1/Rbx1 RING Finger E3 ligase transfers NEDD8 to specific substrates. NEDD8 plays a critical regulatory role in cell proliferation and dysregulation of the NEDD8 pathway has been associated with several cancer pathologies.
Product Categories/Family for NEDD8 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
NEDD8
NCBI Official Synonym Full Names
NEDD8 ubiquitin like modifier
NCBI Official Symbol
NEDD8
NCBI Official Synonym Symbols
NEDD-8
NCBI Protein Information
NEDD8
UniProt Protein Name
NEDD8
Protein Family
UniProt Gene Name
NEDD8
UniProt Synonym Gene Names
NEDD-8
UniProt Entry Name
NEDD8_HUMAN

Uniprot Description

NEDD8: a member of the ubiquitin family of proteins. Approximately 60% identical to ubiquitin protein. Activated by an E1-like complex, consisting of App-b1 and Uba3 and then linked to the E2-like enzyme, Ubc12. The major target protein modified by nedd8 is cullin-4a. Down-regulated during the development of brain.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 14q12

Cellular Component: cytosol; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding

Biological Process: regulation of transcription from RNA polymerase II promoter; ubiquitin-dependent protein catabolic process; anatomical structure morphogenesis; protein localization; protein neddylation; transforming growth factor beta receptor signaling pathway; protein modification process; proteolysis; response to organic cyclic substance

Research Articles on NEDD8

Similar Products

Product Notes

The NEDD8 nedd8 (Catalog #AAA9139662) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MLIKVKTLTG KEIEIDIEPT DKVERIKERV EEKEGIPPQQ QRLIYSGKQM NDEKTAADYK ILGGSVLHLV LALRGG. It is sometimes possible for the material contained within the vial of "NEDD8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.