Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nicotianamine synthase 2 (NAS2) Recombinant Protein | NAS2 recombinant protein

Recombinant Oryza sativa subsp. indica Nicotianamine synthase 2 (NAS2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nicotianamine synthase 2 (NAS2); Recombinant Oryza sativa subsp. indica Nicotianamine synthase 2 (NAS2); NAS2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-326, Full length protein
Sequence
MEAQNQEVAALVEKIAGLHAAISKLPSLSPSAEVDALFTDLVTACVPASPVDVAKLGPEAQAMREELIRLCSAAEGHLEAHYADMLAAFDNPLDHLARFPYYGNYVNLSKLEYDLLVRYVPGIAPTRVAFVGSGPLPFSSLVLAAHHLPDAVFDNYDRCGAANERARRLFRGADEGLGARMAFHTADVATLTGELGAYDVVFLAALVGMAAEEKAGVIAHLGAHMADGAALVVSARHGARGFLYPIVDLEDIRRGGFDVLAVYHPDDEVINSVIVARKADPRRGGGLAGARGAVPVVSPPCKCCKMEAAAGAFQKAEEFAAKRLSV
Sequence Length
326
Species
Oryza sativa subsp. indica (Rice)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
34,456 Da
NCBI Official Full Name
Nicotianamine synthase 2
UniProt Protein Name
Nicotianamine synthase 2
Protein Family
UniProt Gene Name
NAS2
UniProt Synonym Gene Names
OsNAS2

Uniprot Description

Synthesizes nicotianamine, a polyamine that is the first intermediate in the synthesis of the phytosiderophores of the mugineic acid type found in gramineae which serve as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.

Similar Products

Product Notes

The NAS2 nas2 (Catalog #AAA1070184) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-326, Full length protein. The amino acid sequence is listed below: MEAQNQEVAA LVEKIAGLHA AISKLPSLSP SAEVDALFTD LVTACVPASP VDVAKLGPEA QAMREELIRL CSAAEGHLEA HYADMLAAFD NPLDHLARFP YYGNYVNLSK LEYDLLVRYV PGIAPTRVAF VGSGPLPFSS LVLAAHHLPD AVFDNYDRCG AANERARRLF RGADEGLGAR MAFHTADVAT LTGELGAYDV VFLAALVGMA AEEKAGVIAH LGAHMADGAA LVVSARHGAR GFLYPIVDLE DIRRGGFDVL AVYHPDDEVI NSVIVARKAD PRRGGGLAGA RGAVPVVSPP CKCCKMEAAA GAFQKAEEFA AKRLSV. It is sometimes possible for the material contained within the vial of "Nicotianamine synthase 2 (NAS2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.