Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Gamma-soluble NSF attachment protein (NAPG) Recombinant Protein | NAPG recombinant protein

Recombinant Human Gamma-soluble NSF attachment protein (NAPG)

Gene Names
NAPG; GAMMASNAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gamma-soluble NSF attachment protein (NAPG); Recombinant Human Gamma-soluble NSF attachment protein (NAPG); Gamma-soluble NSF attachment protein; SNAP-gamma; N-ethylmaleimide-sensitive factor attachment protein gamma; NAPG recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-312aa; Full Length of BC001889
Sequence
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
Sequence Length
312
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for NAPG recombinant protein
Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
Product Categories/Family for NAPG recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61.7 kDa
NCBI Official Full Name
gamma-soluble NSF attachment protein
NCBI Official Synonym Full Names
N-ethylmaleimide-sensitive factor attachment protein, gamma
NCBI Official Symbol
NAPG
NCBI Official Synonym Symbols
GAMMASNAP
NCBI Protein Information
gamma-soluble NSF attachment protein; SNAP-gamma; gamma SNAP
UniProt Protein Name
Gamma-soluble NSF attachment protein
Protein Family
UniProt Gene Name
NAPG
UniProt Synonym Gene Names
SNAPG; SNAP-gamma
UniProt Entry Name
SNAG_HUMAN

NCBI Description

This gene encodes soluble NSF attachment protein gamma. The soluble NSF attachment proteins (SNAPs) enable N-ethyl-maleimide-sensitive fusion protein (NSF) to bind to target membranes. NSF and SNAPs appear to be general components of the intracellular membrane fusion apparatus, and their action at specific sites of fusion must be controlled by SNAP receptors particular to the membranes being fused. The product of this gene mediates platelet exocytosis and controls the membrane fusion events of this process.[provided by RefSeq, Dec 2008]

Uniprot Description

SNAP-gamma: a cytoplasmic peripheral membrane protein that mediates platelet exocytosis and controls the membrane fusion events of this process. Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 18p11.22

Cellular Component: SNARE complex; mitochondrion; lysosomal membrane

Molecular Function: protein binding; syntaxin binding; soluble NSF attachment protein activity

Biological Process: intracellular protein transport; intra-Golgi vesicle-mediated transport; protein stabilization; protein complex assembly

Research Articles on NAPG

Similar Products

Product Notes

The NAPG napg (Catalog #AAA1372230) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-312aa; Full Length of BC001889. The amino acid sequence is listed below: MAAQKINEGL EHLAKAEKYL KTGFLKWKPD YDSAASEYGK AAVAFKNAKQ FEQAKDACLR EAVAHENNRA LFHAAKAYEQ AGMMLKEMQK LPEAVQLIEK ASMMYLENGT PDTAAMALER AGKLIENVDP EKAVQLYQQT ANVFENDERL RQAVELLGKA SRLLVRGRRF DEAALSIQKE KNIYKEIENY PTCYKKTIAQ VLVHLHRNDY VAAERCVRES YSIPGFNGSE DCAALEQLLE GYDQQDQDQV SDVCNSPLFK YMDNDYAKLG LSLVVPGGGI KKKSPATPQA KPDGVTATAA DEEEDEYSGG LC. It is sometimes possible for the material contained within the vial of "Gamma-soluble NSF attachment protein (NAPG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.