Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human NAPG Monoclonal Antibody | anti-NAPG antibody

NAPG (SNAPG, Gamma-soluble NSF Attachment Protein, N-ethylmaleimide-sensitive Factor Attachment Protein gamma, SNAP-gamma) (PE)

Gene Names
NAPG; GAMMASNAP
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NAPG; Monoclonal Antibody; NAPG (SNAPG; Gamma-soluble NSF Attachment Protein; N-ethylmaleimide-sensitive Factor Attachment Protein gamma; SNAP-gamma) (PE); anti-NAPG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B5
Specificity
Recognizes human NAPG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NAPG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 form NAPG (NP_003817) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(NAPG monoclonal antibody Western Blot analysis of NAPG expression in HepG2.)

Western Blot (WB) (NAPG monoclonal antibody Western Blot analysis of NAPG expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged NAPG is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NAPG is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-NAPG antibody
Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
Product Categories/Family for anti-NAPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,662 Da
NCBI Official Full Name
gamma-soluble NSF attachment protein
NCBI Official Synonym Full Names
N-ethylmaleimide-sensitive factor attachment protein, gamma
NCBI Official Symbol
NAPG
NCBI Official Synonym Symbols
GAMMASNAP
NCBI Protein Information
gamma-soluble NSF attachment protein; SNAP-gamma; gamma SNAP
UniProt Protein Name
Gamma-soluble NSF attachment protein
Protein Family
UniProt Gene Name
NAPG
UniProt Synonym Gene Names
SNAPG; SNAP-gamma
UniProt Entry Name
SNAG_HUMAN

NCBI Description

This gene encodes soluble NSF attachment protein gamma. The soluble NSF attachment proteins (SNAPs) enable N-ethyl-maleimide-sensitive fusion protein (NSF) to bind to target membranes. NSF and SNAPs appear to be general components of the intracellular membrane fusion apparatus, and their action at specific sites of fusion must be controlled by SNAP receptors particular to the membranes being fused. The product of this gene mediates platelet exocytosis and controls the membrane fusion events of this process.[provided by RefSeq, Dec 2008]

Uniprot Description

SNAP-gamma: a cytoplasmic peripheral membrane protein that mediates platelet exocytosis and controls the membrane fusion events of this process. Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 18p11.22

Cellular Component: SNARE complex; mitochondrion; lysosomal membrane

Molecular Function: protein binding; syntaxin binding; soluble NSF attachment protein activity

Biological Process: intra-Golgi vesicle-mediated transport; intracellular protein transport; protein stabilization; protein complex assembly

Research Articles on NAPG

Similar Products

Product Notes

The NAPG napg (Catalog #AAA6158999) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NAPG (SNAPG, Gamma-soluble NSF Attachment Protein, N-ethylmaleimide-sensitive Factor Attachment Protein gamma, SNAP-gamma) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAPG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAPG napg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAPG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.