Nucleosome assembly protein 1-like 4 (Nap1l4) Recombinant Protein | Nap1l4 recombinant protein
Recombinant Mouse Nucleosome assembly protein 1-like 4 (Nap1l4)
Gene Names
Nap1l4; Nap2; AI316776; D7Wsu30e; 2810410H14Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleosome assembly protein 1-like 4 (Nap1l4); Recombinant Mouse Nucleosome assembly protein 1-like 4 (Nap1l4); Nap1l4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-375, full length protein
Sequence
AENSLSDGGPADSVEAAKNASNTEKLTDQVMQNPQVLAALQERLDNVSHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESAWHSENEEEDKLAGDMKNKVVIAEKEAATVEELNPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNPVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFSPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDADVNPKV
Sequence Length
374
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nap1l4 recombinant protein
This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,679 Da
NCBI Official Full Name
nucleosome assembly protein 1-like 4 isoform a
NCBI Official Synonym Full Names
nucleosome assembly protein 1-like 4
NCBI Official Symbol
Nap1l4
NCBI Official Synonym Symbols
Nap2; AI316776; D7Wsu30e; 2810410H14Rik
NCBI Protein Information
nucleosome assembly protein 1-like 4
UniProt Protein Name
Nucleosome assembly protein 1-like 4
UniProt Gene Name
Nap1l4
Uniprot Description
Acts as histone chaperone in nucleosome assembly (PubMed:28366643). In condensing spermatids, mediates the loading of the heterodimer composed of histones H2AFB1 and HIST1H2BA/TH2B onto the nucleosomes, thereby promoting the replacement of histones to protamine in male germ cells (PubMed:28366643).
Research Articles on Nap1l4
Similar Products
Product Notes
The Nap1l4 nap1l4 (Catalog #AAA1329421) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-375, full length protein. The amino acid sequence is listed below: AENSLSDGGP ADSVEAAKNA SNTEKLTDQV MQNPQVLAAL QERLDNVSHT PSSYIETLPK AVKRRINALK QLQVRCAHIE AKFYEEVHDL ERKYAALYQP LFDKRREFIT GDVEPTDAES AWHSENEEED KLAGDMKNKV VIAEKEAATV EELNPKGIPE FWFTIFRNVD MLSELVQEYD EPILKHLQDI KVKFSDPGQP MSFVLEFHFE PNDYFTNPVL TKTYKMKSEP DKADPFSFEG PEIVDCDGCT IDWKKGKNVT VKTIKKKQKH KGRGTVRTIT KQVPNESFFN FFSPLKASGD GESLDEDSEF TLASDFEIGH FFRERIVPRA VLYFTGEAIE DDDNFEEGEE GEEEELEGDE EGEDEDDADV NPKV. It is sometimes possible for the material contained within the vial of "Nucleosome assembly protein 1-like 4 (Nap1l4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
