Nucleosome assembly protein 1-like 1-B (nap1l1-b) Recombinant Protein | nap1l1-b recombinant protein
Recombinant Xenopus laevis Nucleosome assembly protein 1-like 1-B (nap1l1-b)
Gene Names
nap1l1.L; NAP1; nap1-B; nap1l1; xNAP-1; xnap1l; xnap1l1; nap1l1-a; nap1l1-b; nap1l1.S; xNAP1L-B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleosome assembly protein 1-like 1-B (nap1l1-b); Recombinant Xenopus laevis Nucleosome assembly protein 1-like 1-B (nap1l1-b); nap1l1-b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-393, Full length protein
Sequence
MANIDNKEQTELDQQDMEDVEDVEEEETGEEANSKARQLTAQMMQNPQVLAALQERLDDLVGTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPFFEKRSDIINASYEPTEEECEWKVDEEEDIAEDLKEKAKLEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSEAGQPMNFMLEFHFEPNEFFTNELLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENGELDDDAEAILTADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADDEEGEEEADEDHDPDFDPKKAQNPAECKQQ
Sequence Length
393
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,389 Da
NCBI Official Full Name
nucleosome assembly protein 1-like 1-B
NCBI Official Synonym Full Names
nucleosome assembly protein 1 like 1 L homeolog
NCBI Official Symbol
nap1l1.L
NCBI Official Synonym Symbols
NAP1; nap1-B; nap1l1; xNAP-1; xnap1l; xnap1l1; nap1l1-a; nap1l1-b; nap1l1.S; xNAP1L-B
NCBI Protein Information
nucleosome assembly protein 1-like 1-B
UniProt Protein Name
Nucleosome assembly protein 1-like 1-B
Protein Family
UniProt Gene Name
nap1l1-b
UniProt Synonym Gene Names
nap1-b; xNAP-1
Uniprot Description
Acts as a chaperone for the linker histone to facilitate deposition of histone B4 onto linker DNA. Required for both remodeling of sperm chromatin into nucleosomes, and linker histone binding to nucleosome core dimers. Plays a role in tissue-specific gene regulation. Required for primitive hemopoiesis, acting upstream of tal1/scl.
Similar Products
Product Notes
The nap1l1-b nap1l1-b (Catalog #AAA1462579) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-393, Full length protein. The amino acid sequence is listed below: MANIDNKEQT ELDQQDMEDV EDVEEEETGE EANSKARQLT AQMMQNPQVL AALQERLDDL VGTPTGYIES LPKVVKRRVN ALKNLQVKCA QIEAKFYEEV HELERKYAAL YQPFFEKRSD IINASYEPTE EECEWKVDEE EDIAEDLKEK AKLEEEKKDE EKEDPKGIPE FWLTVFKNVD LLSDMVQEHD EPILKHLKDI KVKFSEAGQP MNFMLEFHFE PNEFFTNELL TKTYKMRSEP DESDPFSFDG PEIMGCTGCL IDWKKGKNVT LKTIKKKQKH KGRGTVRTVT KTVPNDSFFN FFSPPEVPEN GELDDDAEAI LTADFEIGHF LRERIIPRSV LYFTGEAIED DDDDYDEEGE EADDEEGEEE ADEDHDPDFD PKKAQNPAEC KQQ. It is sometimes possible for the material contained within the vial of "Nucleosome assembly protein 1-like 1-B (nap1l1-b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
