Homeobox Protein NANOG (NANOG) Recombinant Protein | NANOG recombinant protein

Recombinant Human Homeobox Protein NANOG (NANOG)

Cat. Num. AAA7115344

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Homeobox Protein NANOG (NANOG); Recombinant Human Homeobox Protein NANOG (NANOG); Homeobox transcription factor Nanog; hNanog; NANOG recombinant protein

• Host: E Coli
• Specificity: Expressed in testicular carcinoma and derived germ cell tumors (at protein level). Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-305aa; Full Length
• Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV
• Sequence Length: 305

• Species: Human
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Subcellular Location: Nucleus
• Protein Families: Nanog homeobox family
• Pathway: Signaling Pathways Regulating Pluripotency Of Stem Cells
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for NANOG recombinant protein

Transcription regulator involved in inner cell mass and embryonic stem cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. Binds to the POU5F1/OCT4 promoter. Able to autorepress its expression in differentiating (ES) cells: binds to its own promoter following interaction with ZNF281/ZFP281, leading to recruitment of the NuRD complex and subsequent repression of expression. When overexpressed, promotes cells to enter into S phase and proliferation.

Product Categories/Family for NANOG recombinant protein

Cancer

References

"Pluripotential competence of cells associated with Nanog activity." Hatano S.Y., Tada M., Kimura H., Yamaguchi S., Kono T., Nakano T., Suemori H., Nakatsuji N., Tada T. Mech. Dev. 122:67-79(2005).

NCBI and Uniprot Product Information

• NCBI GI #: 118573073
• NCBI GeneID: 79923
• UniProt Accession #: Q9H9S0
• Molecular Weight: 39.6 kDa
• NCBI Official Full Name: Homeobox protein NANOG
• NCBI Official Synonym Full Names: Nanog homeobox
• NCBI Official Symbol: NANOG
• NCBI Protein Information: homeobox protein NANOG
• UniProt Protein Name: Homeobox protein NANOG
• Protein Family: Homeobox protein
• UniProt Gene Name: NANOG
• UniProt Synonym Gene Names: hNanog
• UniProt Entry Name: NANOG_HUMAN

NCBI Description

The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

NANOG: Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. When overexpressed, promotes cells to enter into S phase and proliferation. Interacts with SMAD1 and SALL4. Expressed in testicular carcinoma and derived germ cell tumors. Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes. Belongs to the Nanog homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; Cell development/differentiation

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: DNA binding; chromatin binding; transcription factor activity; transcription corepressor activity

Biological Process: response to retinoic acid; gonad development; transcription, DNA-dependent; somatic stem cell maintenance; stem cell division; endodermal cell fate specification; stem cell maintenance; negative regulation of transcription from RNA polymerase II promoter; positive regulation of mitotic cell cycle; embryonic pattern specification; mesodermal cell fate commitment; negative regulation of cell fate commitment; negative regulation of BMP signaling pathway; cell proliferation; regulation of transcription, DNA-dependent; regulation of gene expression; regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; cell differentiation