Western Blot (WB)
(MOBKL2C polyclonal antibody. Western Blot analysis of MOBKL2C expression in human pancreas)
Mouse anti-Human MOBKL2C Polyclonal Antibody | anti-MOB3C antibody
MOBKL2C (MOB Kinase Activator 3C, Mob1 Homolog 2C, Mps One Binder Kinase Activator-like 2C, MOBKL2C, MGC26743)
Gene Names
MOB3C; MOB1E; MOBKL2C
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MOBKL2C; Polyclonal Antibody; MOBKL2C (MOB Kinase Activator 3C; Mob1 Homolog 2C; Mps One Binder Kinase Activator-like 2C; MGC26743); Anti -MOBKL2C (MOB Kinase Activator 3C; anti-MOB3C antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MOBKL2C.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH
Applicable Applications for anti-MOB3C antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MOBKL2C, aa1-216 (NP_958805.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(MOBKL2C polyclonal antibody. Western Blot analysis of MOBKL2C expression in human pancreas)
Western Blot (WB)
(MOBKL2C polyclonal antibody. Western Blot analysis of MOBKL2C expression in human pancreas)
Western Blot (WB)
(Western Blot analysis of MOBKL2C expression in transfected 293T cell line by MOBKL2C polyclonal antibody. Lane 1: MOBKL2C transfected lysate (23.76kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MOBKL2C expression in transfected 293T cell line by MOBKL2C polyclonal antibody. Lane 1: MOBKL2C transfected lysate (23.76kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MOB3C antibody
May regulate the activity of kinases.
Product Categories/Family for anti-MOB3C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,623 Da
NCBI Official Full Name
MOB kinase activator 3C isoform 2
NCBI Official Synonym Full Names
MOB kinase activator 3C
NCBI Official Symbol
MOB3C
NCBI Official Synonym Symbols
MOB1E; MOBKL2C
NCBI Protein Information
MOB kinase activator 3C; mob1 homolog 2C; MOB1, Mps One Binder kinase activator-like 2C
UniProt Protein Name
MOB kinase activator 3C
Protein Family
UniProt Gene Name
MOB3C
UniProt Synonym Gene Names
MOBKL2C
UniProt Entry Name
MOB3C_HUMAN
NCBI Description
The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Uniprot Description
MOBKL2C: May regulate the activity of kinases. Belongs to the MOB1/phocein family.
Chromosomal Location of Human Ortholog: 1p33
Molecular Function: metal ion binding
Similar Products
Product Notes
The MOB3C mob3c (Catalog #AAA6007794) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MOBKL2C (MOB Kinase Activator 3C, Mob1 Homolog 2C, Mps One Binder Kinase Activator-like 2C, MOBKL2C, MGC26743) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MOBKL2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MOB3C mob3c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALCLKQVFA KDKTFRPRKR FEPGTQRFEL YKKAQASLKS GLDLRSVVRL PPGENIDDWI AVHVVDFFNR INLIYGTMAE RCSETSCPVM AGGPRYEYRW QDERQYRRPA KLSAPRYMAL LMDWIEGLIN DEEVFPTRVG VPFPKNFQQV CTKILTRLFR VFVHVYIHHF DSILSMGAEA HVNTCYKHFY YFIREFSLVD QRELEPLREM TERICH. It is sometimes possible for the material contained within the vial of "MOBKL2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
