N(6)-adenine-specific DNA methyltransferase 2 Recombinant Protein | N6AMT2 recombinant protein

Recombinant Human N(6)-adenine-specific DNA methyltransferase 2

Cat. Num. AAA1290957

• Gene Names: EEF1AKMT1; ESP13; N6AMT2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: N(6)-adenine-specific DNA methyltransferase 2; Recombinant Human N(6)-adenine-specific DNA methyltransferase 2; N6AMT2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-214aa; Full Length
• Sequence: SDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI
• Sequence Length: 214

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for N6AMT2 recombinant protein

S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that methylates elongation factor 1-alpha.

Product Categories/Family for N6AMT2 recombinant protein

Epigenetics and Nuclear Signaling

References

Transcriptome analysis of a cDNA library from adult human epididymis.Li J.Y., Wang H.Y., Liu J., Liu Q., Zhang J.S., Wan F.C., Liu F.J., Jin S.H., Zhang Y.L.DNA Res. 15:115-122(2008) The DNA sequence and analysis of human chromosome 13.Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.Nature 428:522-528(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 28372547
• NCBI GeneID: 221143
• NCBI Accession #: NP_777588.1
• NCBI GenBank Nucleotide #: NM_174928.2
• UniProt Accession #: Q8WVE0; B5G4V1
• Molecular Weight: 40.4 kDa
• NCBI Official Full Name: protein-lysine N-methyltransferase N6AMT2
• NCBI Official Synonym Full Names: eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1
• NCBI Official Symbol: EEF1AKMT1
• NCBI Official Synonym Symbols: ESP13; N6AMT2
• NCBI Protein Information: protein-lysine N-methyltransferase N6AMT2
• UniProt Protein Name: Protein-lysine N-methyltransferase N6AMT2
• Protein Family: Protein-lysine N-methyltransferase
• UniProt Gene Name: N6AMT2
• UniProt Entry Name: N6MT2_HUMAN

Uniprot Description

N6AMT2: Putative DNA methyltransferase. Belongs to the methyltransferase superfamily. AML1 family.

Protein type: EC 2.1.1.-; Methyltransferase

Chromosomal Location of Human Ortholog: 13q12.11

Cellular Component: cytoplasm

Molecular Function: nucleic acid binding; protein-lysine N-methyltransferase activity

Biological Process: peptidyl-lysine methylation