DNA circularization protein (N) Recombinant Protein | Mup43 recombinant protein
Recombinant Enterobacteria phage Mu DNA circularization protein (N)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA circularization protein (N); Recombinant Enterobacteria phage Mu DNA circularization protein (N); Mup43 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-495, Full length protein
Sequence
MFEDALNAVNAVRDKTGGGRKTTGKGTFRNVPFLVIEEQKQAGGRRLVKREYPLRDTGGVNDLGKKLRSRTFSACILNSNAETARDEAGALMDALDAPGSGELVHPDFGTVDVMVDSWECRTKADELNYYAFTVTVYPSLQDTAPDAETDTSAAVPAQAVAVTGSLGDTLSSVWQTVKDGTAAATAVMEAVTGVIDDISDAVDNLGVTQTVSGLMGSLSAMKGSVTSLINQPAMLASSLMGALSGVSSLCDTRTAFSTWNRLAQRFERRHAATAGRQGTITTSYNSPVAEKNIATLNYVMLAAAQTYRAEAASQALTAALDFSRRMDNAARAPVLDAPSTTTGTASGASSTSATVTQGQLQLTAITPDGGFSQVSFSDSGTATPPVFESVSDIEKTTAMLGAALDSVILTASEQGFSTDSVQLTQLRLLVVADLEKRGLQLAGSESHHLPETLPAMVALYRFTGNSRNWQRLARRNGISNPLFVPGGVSIEVINE
Sequence Length
495
Species
Enterobacteria phage Mu (Bacteriophage Mu)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,041 Da
NCBI Official Full Name
putative DNA circulation protein
NCBI Official Symbol
Mup43
UniProt Protein Name
DNA circularization protein N
UniProt Gene Name
N
UniProt Synonym Gene Names
gp43; gpN
Uniprot Description
Required for tail assembly of phage Mu and responsible for circularizing the viral DNA after it has been ejected into the host cell. Following infection, the circularized DNA can be isolated as a supercoiled, non-covalent protein-DNA complex, in which the protein N is bound to the ends of the DNA. Protects linear double-stranded DNA of viral genome from host exonuclease degradation.
Similar Products
Product Notes
The Mup43 n (Catalog #AAA1125257) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-495, Full length protein. The amino acid sequence is listed below: MFEDALNAVN AVRDKTGGGR KTTGKGTFRN VPFLVIEEQK QAGGRRLVKR EYPLRDTGGV NDLGKKLRSR TFSACILNSN AETARDEAGA LMDALDAPGS GELVHPDFGT VDVMVDSWEC RTKADELNYY AFTVTVYPSL QDTAPDAETD TSAAVPAQAV AVTGSLGDTL SSVWQTVKDG TAAATAVMEA VTGVIDDISD AVDNLGVTQT VSGLMGSLSA MKGSVTSLIN QPAMLASSLM GALSGVSSLC DTRTAFSTWN RLAQRFERRH AATAGRQGTI TTSYNSPVAE KNIATLNYVM LAAAQTYRAE AASQALTAAL DFSRRMDNAA RAPVLDAPST TTGTASGASS TSATVTQGQL QLTAITPDGG FSQVSFSDSG TATPPVFESV SDIEKTTAML GAALDSVILT ASEQGFSTDS VQLTQLRLLV VADLEKRGLQ LAGSESHHLP ETLPAMVALY RFTGNSRNWQ RLARRNGISN PLFVPGGVSI EVINE. It is sometimes possible for the material contained within the vial of "DNA circularization protein (N), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
