Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2) Recombinant Protein | MYL2 recombinant protein

Recombinant Rabbit Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2)

Cat. Num. AAA1439584

• Gene Names: MYL2; MLC-2; MLC-2v; MLC-2s/v
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Myosin regulatory light chain 2; ventricular/cardiac muscle isoform (MYL2); Recombinant Rabbit Myosin regulatory light chain 2; MYL2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-165, Full length protein
• Sequence: SPKKAKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKDEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEK
• Sequence Length: 164

• Species: Rabbit
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for MYL2 recombinant protein

Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

NCBI and Uniprot Product Information

• NCBI GI #: 143354785
• NCBI GeneID: 100353304
• UniProt Accession #: Q7M2V4
• Molecular Weight: 18,762 Da
• NCBI Official Full Name: Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
• NCBI Official Symbol: MYL2
• NCBI Official Synonym Symbols: MLC-2; MLC-2v; MLC-2s/v
• NCBI Protein Information: myosin regulatory light chain 2, ventricular/cardiac muscle isoform
• UniProt Protein Name: Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
• Protein Family: Myosin regulatory
• UniProt Gene Name: MYL2
• UniProt Synonym Gene Names: MLC-2s/v

Uniprot Description

Contractile protein that plays a role in heart development and function (). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly ().