SDS-PAGE
Muc5ac recombinant protein
Recombinant Mouse Protein Muc5ac
Gene Names
MUC5AC; TBM; leB; MUC5; mucin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Muc5ac; Recombinant Mouse Protein Muc5ac; Muc5ac recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2452-2721aa; Partial
Sequence
CPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVVSSSLCERCLCEVSSNPLSDVFMVSCETELCNTQCPKGSEYQAMPGQCCGKCIPKTCPFKNNSGSTYFYQPGELWAEPGNPCVTHKCEKFQDVLMVVTMKTECPKINCPQGQAQLREDGCCYDCPLPNQQKCTVHQRQQIIRQQNCSSEGPVSISYCQGNCGDSISMYSLEANKVEHTCECCQELQTSQRNVTLRCDDGSSQTFSYTQVEKCGCLGQQCHALGDTSHAES
Sequence Length
5654
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Muc5ac recombinant protein
Gel-forming glycoprotein of gastric and respiratoy tract epithelia that protects the mucosa from infection and chical damage by binding to inhaled microrganisms and particles that are subsequently roved by the mucocilary system.
References
Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Human mucin gene MUC5AC
organization of its 5'-region and central repetitive region.Escande F., Aubert J.-P., Porchet N., Buisine M.P.Biochem. J. 358:763-772(2001)
Cloning of the amino-terminal and 5'-flanking region of the human MUC5AC mucin gene and transcriptional up-regulation by bacterial exoproducts.Li D., Gallup M., Fan N., Szymkowski D.E., Basbaum C.B.J. Biol. Chem. 273:6812-6820(1998)
Cloning and analysis of human gastric mucin cDNA reveals two types of conserved cysteine-rich domains.Klomp L.W., Van Rens L., Strous G.J.Biochem. J. 308:831-838(1995)
Proteolytic fragmentation and peptide mapping of human carboxyamidomethylated tracheobronchial mucin.Rose M.C., Kaufman B., Martin B.M.J. Biol. Chem. 264:8193-8199(1989)
Genomic organization of the 3'-region of the human MUC5AC mucin gene
additional evidence for a common ancestral gene for the 11p15.5 mucin gene family.Buisine M.P., Desseyn J.-L., Porchet N., Degand P., Laine A., Aubert J.-P.Biochem. J. 332:729-738(1998)
Cloning and analysis of cDNA encoding a major airway glycoprotein, human tracheobronchial mucin (MUC5)
.Meerzaman D., Charles P., Daskal E., Polymeropoulos M.H., Martin B.M., Rose M.C.J. Biol. Chem. 269:12932-12939(1994)
Characterization of a mucin cDNA clone isolated from HT-29 mucus secreting cells
the 3' end of MUC5AC?Lesuffleur T., Roche F., Hill A.S., Lacasa M., Fox M., Swallow D.M., Zweibaum A., Real F.X.J. Biol. Chem. 270:13665-13673(1995)
Cleavage in the GDPH sequence of the C-terminal cysteine-rich part of the human MUC5AC mucin.Lidell M.E., Hansson G.C.Biochem. J. 399:121-129(2006)
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
In vivo glycosylation of mucin tandem repeats.Silverman H.S., Parry S., Sutton-Smith M., Burdick M.D., McDermott K., Reid C.J., Batra S.K., Morris H.R., Hollingsworth M.A., Dell A., Harris A.Glycobiology 11:459-471(2001)
The MUC5AC glycoprotein is the primary receptor for Helicobacter pylori in the human stomach.Van de Bovenkamp J.H., Mahdavi J., Korteland-Van Male A.M., Bueller H.A., Einerhand A.W., Boren T., Dekker J.Helicobacter 8:521-532(2003)
C-Mannosylation of MUC5AC and MUC5B Cys subdomains.Perez-Vilar J., Randell S.H., Boucher R.C.Glycobiology 14:325-337(2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.6 kDa
NCBI Official Full Name
mucin-5AC
NCBI Official Synonym Full Names
mucin 5AC, oligomeric mucus/gel-forming
NCBI Official Symbol
MUC5AC
NCBI Official Synonym Symbols
TBM; leB; MUC5; mucin
NCBI Protein Information
mucin-5AC
UniProt Protein Name
Mucin-5AC
Protein Family
UniProt Gene Name
MUC5AC
UniProt Synonym Gene Names
TBM
UniProt Entry Name
MUC5A_HUMAN
Uniprot Description
MUC5AC iso1:
Chromosomal Location of Human Ortholog: 11p15.5
Cellular Component: cytoplasm; extracellular space; fibril; Golgi lumen
Molecular Function: extracellular matrix structural constituent
Biological Process: cellular protein metabolic process; fibril organization and biogenesis; O-glycan processing; phosphoinositide-mediated signaling; post-translational protein modification; protein amino acid O-linked glycosylation
Research Articles on Muc5ac
Similar Products
Product Notes
The Muc5ac muc5ac (Catalog #AAA1265547) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2452-2721aa; Partial. The amino acid sequence is listed below: CPKNSSLIVT YEEGACCPTQ NCSSQKGCEV NGTLYQPGDV VSSSLCERCL CEVSSNPLSD VFMVSCETEL CNTQCPKGSE YQAMPGQCCG KCIPKTCPFK NNSGSTYFYQ PGELWAEPGN PCVTHKCEKF QDVLMVVTMK TECPKINCPQ GQAQLREDGC CYDCPLPNQQ KCTVHQRQQI IRQQNCSSEG PVSISYCQGN CGDSISMYSL EANKVEHTCE CCQELQTSQR NVTLRCDDGS SQTFSYTQVE KCGCLGQQCH ALGDTSHAES. It is sometimes possible for the material contained within the vial of "Muc5ac, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
