G-protein coupled receptor Mth (mth) Recombinant Protein | Dsimmth recombinant protein
Recombinant Drosophila simulans G-protein coupled receptor Mth (mth)
Gene Names
Dsimmth; DsimGD25710; dsim_GLEANR_9699; GD25710; Mth
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G-protein coupled receptor Mth (mth); Recombinant Drosophila simulans G-protein coupled receptor Mth (mth); Recombinant G-protein coupled receptor Mth (mth); G-protein coupled receptor Mth; Protein methuselah; Dsimmth recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-515
Sequence
DILECDYFDTVDISAAQKLQNGSYLFEGLLVPAILTGEYDFRILPDDSKQKVASHIRGCVCKLKPCVRFCCPHDHIMDNGVCNDNMSEEELTELDPFLNVTLDDGSVSRRHFKNELIVQWDLPMPCDGMFYLDNREEQDQYTLFENGTFFRHFDRVTLSKREYCLQHLTFADGNATSIRIAPHNCLIVPSITGQTVVMITSLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLFDLWQISISFCKPAGVLGYFFVMAAFLWLSVISLHLWNTFRGSSHKASRFFSEHRFLAYNTYAWGMSMVLTGITVLADNVVEDQDWNPRVGEEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTARRIIGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYISQSNQTWANVFLVADYLNWSQGIIIFILFILKRSTLRLLQESIRGEGEEVDNSEEEISLENTRFDRNVLS
Sequence Length
515
Species
Drosophila simulans (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59,601 Da
NCBI Official Full Name
mth
NCBI Official Symbol
Dsimmth
NCBI Official Synonym Symbols
DsimGD25710; dsim_GLEANR_9699; GD25710; Mth
NCBI Protein Information
GD25710 gene product from transcript GD25710-RA; DsimGD25710-PA; Dsimmth-PA
UniProt Protein Name
G-protein coupled receptor Mth
UniProt Gene Name
mth
UniProt Entry Name
MTH_DROSI
Uniprot Description
Function: Involved in biological aging and stress response. Essential for adult survival
By similarity.
Subunit structure: Homodimer
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the G-protein coupled receptor 2 family. Mth subfamily.
Similar Products
Product Notes
The Dsimmth mth (Catalog #AAA1044610) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-515. The amino acid sequence is listed below: DILECDYFDT VDISAAQKLQ NGSYLFEGLL VPAILTGEYD FRILPDDSKQ KVASHIRGCV CKLKPCVRFC CPHDHIMDNG VCNDNMSEEE LTELDPFLNV TLDDGSVSRR HFKNELIVQW DLPMPCDGMF YLDNREEQDQ YTLFENGTFF RHFDRVTLSK REYCLQHLTF ADGNATSIRI APHNCLIVPS ITGQTVVMIT SLICMVLTIA VYLFVKKLQN LHGKCFICYM VCLFMGYLFL LFDLWQISIS FCKPAGVLGY FFVMAAFLWL SVISLHLWNT FRGSSHKASR FFSEHRFLAY NTYAWGMSMV LTGITVLADN VVEDQDWNPR VGEEGHCWIY TQAWSAMLYF YGPMVFLIAF NITMFILTAR RIIGVKKDIQ NFAHRQERKQ KLNSDKQTYT FFLRLFIIMG LSWSLEIGSY ISQSNQTWAN VFLVADYLNW SQGIIIFILF ILKRSTLRLL QESIRGEGEE VDNSEEEISL ENTRFDRNVL S. It is sometimes possible for the material contained within the vial of "G-protein coupled receptor Mth (mth), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
