Wdr8 blocking peptide
Wdr8 Peptide - N-terminal region
Gene Names
Wrap73; Dd57; Wdr8; 2610044M17Rik; 5330425N03Rik
Reactivity
Mouse
Applications
Western Blot
Synonyms
Wdr8; Wdr8 Peptide - N-terminal region; Wdr8 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
RYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAA
Sequence Length
462
Applicable Applications for Wdr8 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Wdr8 blocking peptide
The function of this protein remains unknown.
Product Categories/Family for Wdr8 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
WD repeat-containing protein WRAP73
NCBI Official Synonym Full Names
WD repeat containing, antisense to Trp73
NCBI Official Symbol
Wrap73
NCBI Official Synonym Symbols
Dd57; Wdr8; 2610044M17Rik; 5330425N03Rik
NCBI Protein Information
WD repeat-containing protein WRAP73
UniProt Protein Name
WD repeat-containing protein WRAP73
UniProt Gene Name
Wrap73
UniProt Synonym Gene Names
Dd57; Wdr8
Uniprot Description
The SSX2IP:WRAP73 complex is proposed to act as regulator of spindle anchoring at the mitotic centrosome. Required for the centrosomal localization of SSX2IP and normal mitotic bipolar spindle morphology. Required for the targeting of centriole satellite proteins to centrosomes such as of PCM1, SSX2IP, CEP290 and PIBF1/CEP90. Required for ciliogenesis and involved in the removal of the CEP97:CCP110 complex from the mother centriole. Involved in ciliary vesicle formation at the mother centriole and required for the docking of vesicles to the basal body during ciliogenesis; may promote docking of RAB8A- and ARL13B-containing vesicles ().
Similar Products
Product Notes
The Wdr8 wrap73 (Catalog #AAA3230734) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Wdr8 Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Wdr8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Wdr8 wrap73 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RYLALAERRD CRDYVSIFVC SDWQLLRHFD TDTQDLTGIE WAPNGCVLAA. It is sometimes possible for the material contained within the vial of "Wdr8, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
