Wdr12 blocking peptide
Wdr12 Peptide - middle region
Gene Names
Wdr12; Ytm1; Ytm1p; 4933402C23Rik
Reactivity
Mouse
Applications
Western Blot
Synonyms
Wdr12; Wdr12 Peptide - middle region; Wdr12 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
SGAKFCSGSWDKMLKIWSTVPTDEEDEMEEATNRPRKKQKTEQLGLTRTP
Sequence Length
423
Applicable Applications for Wdr12 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Wdr12 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Wdr12 Antibody, made
Target Description: Wdr12 is a component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.
Target Description: Wdr12 is a component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.
Product Categories/Family for Wdr12 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
ribosome biogenesis protein WDR12
NCBI Official Synonym Full Names
WD repeat domain 12
NCBI Official Symbol
Wdr12
NCBI Official Synonym Symbols
Ytm1; Ytm1p; 4933402C23Rik
NCBI Protein Information
ribosome biogenesis protein WDR12
UniProt Protein Name
Ribosome biogenesis protein WDR12
Protein Family
UniProt Gene Name
Wdr12
UniProt Synonym Gene Names
MNCb-5414
UniProt Entry Name
WDR12_MOUSE
Research Articles on Wdr12
Similar Products
Product Notes
The Wdr12 wdr12 (Catalog #AAA3230738) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Wdr12 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Wdr12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Wdr12 wdr12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SGAKFCSGSW DKMLKIWSTV PTDEEDEMEE ATNRPRKKQK TEQLGLTRTP. It is sometimes possible for the material contained within the vial of "Wdr12, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
